StarFunc result for job id P51654

User Input

>input (580 residues)
MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGS
DLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVR
HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYT
QLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVI
NTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYI
LSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSA
YYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDT
LCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPK
GRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQ
QATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13265	0.846	0.823	7.424E-69	597	0.931	0.905	P13265.pdb.gz	GPC3_RAT Glypican-3 OS=Rattus norvegicus OX=10116 GN=Gpc3 PE=1 SV=1
2	AFDB:Q6V9Y8	0.699	0.687	1.084E-36	590	0.421	0.414	Q6V9Y8.pdb.gz	GPC3_DANRE Glypican-3 OS=Danio rerio OX=7955 GN=gpc3 PE=1 SV=1
3	AFDB:P78333	0.692	0.701	1.172E-35	572	0.407	0.413	P78333.pdb.gz	GPC5_HUMAN Glypican-5 OS=Homo sapiens OX=9606 GN=GPC5 PE=1 SV=1
4	AFDB:Q8CAL5	0.694	0.703	1.450E-35	572	0.402	0.407	Q8CAL5.pdb.gz	GPC5_MOUSE Glypican-5 OS=Mus musculus OX=10090 GN=Gpc5 PE=2 SV=1
5	AFDB:A0A096MJY1	0.651	0.678	1.465E-24	555	0.236	0.247	A0A096MJY1.pdb.gz	A0A096MJY1_RAT Glypican 6 OS=Rattus norvegicus OX=10116 GN=Gpc6 PE=3 SV=1
6	AFDB:B3DJ94	0.606	0.628	5.920E-23	557	0.243	0.253	B3DJ94.pdb.gz	B3DJ94_DANRE Glypican-4 precursor OS=Danio rerio OX=7955 GN=kny PE=1 SV=1
7	AFDB:P51655	0.630	0.653	1.386E-22	557	0.205	0.214	P51655.pdb.gz	GPC4_MOUSE Glypican-4 OS=Mus musculus OX=10090 GN=Gpc4 PE=1 SV=2
8	AFDB:Q6QA54	0.631	0.662	1.642E-22	550	0.212	0.224	Q6QA54.pdb.gz	Q6QA54_MELGA Glypican-1 OS=Meleagris gallopavo OX=9103 PE=2 SV=2
9	AFDB:F1QCC6	0.625	0.652	2.308E-22	554	0.219	0.229	F1QCC6.pdb.gz	GPC1_DANRE Glypican-1 OS=Danio rerio OX=7955 GN=gpc1 PE=2 SV=1
10	AFDB:P35053	0.637	0.660	2.308E-22	558	0.205	0.213	P35053.pdb.gz	GPC1_RAT Glypican-1 OS=Rattus norvegicus OX=10116 GN=Gpc1 PE=1 SV=1
11	PDB:4ywtB	0.604	0.794	1.247E-19	431	0.176	0.237	4ywtB.pdb.gz	Structural Aspects of N-Glycosylations and the C-terminal Region in Human Glypican-1.
12	PDB:4ywtA	0.559	0.764	1.283E-17	411	0.171	0.241	4ywtA.pdb.gz	Structural Aspects of N-Glycosylations and the C-terminal Region in Human Glypican-1.
13	PDB:4ad7C	0.547	0.798	1.869E-16	385	0.153	0.231	4ad7C.pdb.gz
14	PDB:4ad7A	0.498	0.781	3.344E-14	358	0.148	0.240	4ad7A.pdb.gz
15	PDB:7p5jA	0.099	0.132	1.058E-1	399	0.062	0.090	7p5jA.pdb.gz
16	PDB:6ob6B	0.077	0.108	1.425E-1	357	0.081	0.132	6ob6B.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
17	PDB:6ikoA	0.085	0.147	3.787E-1	303	0.064	0.122	6ikoA.pdb.gz
18	PDB:6s4mA	0.079	0.098	3.787E-1	426	0.064	0.087	6s4mA.pdb.gz
19	PDB:7p54A	0.094	0.126	4.303E-1	397	0.052	0.076	7p54A.pdb.gz
20	PDB:6bgjA	0.090	0.102	5.322E-1	490	0.102	0.120	6bgjA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I6QTG3	0.0	1213	580	1.000	1.000	I6QTG3_HUMAN Glypican 3 isoform 2 OS=Homo sapiens OX=9606 GN=GPC3 PE=2 SV=1
2	P13265	0.0	1110	597	0.933	0.906	GPC3_RAT Glypican-3 OS=Rattus norvegicus OX=10116 GN=Gpc3 PE=1 SV=1
3	P51654	0.0	1213	580	1.000	1.000	GPC3_HUMAN Glypican-3 OS=Homo sapiens OX=9606 GN=GPC3 PE=1 SV=1
4	Q8CFZ4	0.0	1127	579	0.940	0.941	GPC3_MOUSE Glypican-3 OS=Mus musculus OX=10090 GN=Gpc3 PE=1 SV=1
5	Q8IYG2	0.0	1210	580	0.998	0.998	Q8IYG2_HUMAN Glypican 3 OS=Homo sapiens OX=9606 GN=GPC3 PE=1 SV=1
6	Q6V9Y8	5.95e-153	453	590	0.405	0.398	GPC3_DANRE Glypican-3 OS=Danio rerio OX=7955 GN=gpc3 PE=1 SV=1
7	Q8CAL5	1.04e-152	452	572	0.393	0.399	GPC5_MOUSE Glypican-5 OS=Mus musculus OX=10090 GN=Gpc5 PE=2 SV=1
8	P78333	2.21e-152	451	572	0.393	0.399	GPC5_HUMAN Glypican-5 OS=Homo sapiens OX=9606 GN=GPC5 PE=1 SV=1
9	A0A096MJY1	3.73e-51	186	555	0.217	0.227	A0A096MJY1_RAT Glypican 6 OS=Rattus norvegicus OX=10116 GN=Gpc6 PE=3 SV=1
10	Q9R087	4.09e-51	186	555	0.217	0.227	GPC6_MOUSE Glypican-6 OS=Mus musculus OX=10090 GN=Gpc6 PE=1 SV=1
11	Q9Y625	4.26e-51	186	555	0.217	0.227	GPC6_HUMAN Glypican-6 OS=Homo sapiens OX=9606 GN=GPC6 PE=1 SV=1
12	A0A8I6A609	6.91e-51	186	565	0.217	0.223	A0A8I6A609_RAT Glypican 6 OS=Rattus norvegicus OX=10116 GN=Gpc6 PE=1 SV=1
13	Q9QZF2	5.41e-48	177	557	0.195	0.203	GPC1_MOUSE Glypican-1 OS=Mus musculus OX=10090 GN=Gpc1 PE=1 SV=1
14	Q642B0	7.32e-47	174	557	0.205	0.214	Q642B0_RAT Glypican 4 OS=Rattus norvegicus OX=10116 GN=Gpc4 PE=1 SV=1
15	P51655	7.45e-46	172	557	0.203	0.212	GPC4_MOUSE Glypican-4 OS=Mus musculus OX=10090 GN=Gpc4 PE=1 SV=2
16	O75487	7.87e-46	172	556	0.203	0.212	GPC4_HUMAN Glypican-4 OS=Homo sapiens OX=9606 GN=GPC4 PE=1 SV=4
17	A0A384NPH9	2.32e-45	170	558	0.195	0.203	A0A384NPH9_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
18	P35052	2.32e-45	170	558	0.195	0.203	GPC1_HUMAN Glypican-1 OS=Homo sapiens OX=9606 GN=GPC1 PE=1 SV=2
19	P35053	6.71e-45	169	558	0.197	0.204	GPC1_RAT Glypican-1 OS=Rattus norvegicus OX=10116 GN=Gpc1 PE=1 SV=1
20	B3DJ94	1.26e-44	168	557	0.245	0.255	B3DJ94_DANRE Glypican-4 precursor OS=Danio rerio OX=7955 GN=kny PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01153 Glypican	8.3e-184	624.1	Glypican

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000040816

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000009646	0.981	Intercellular signal essential for a variety of patterning events during development
2	9544.ENSMMUP00000001060	0.949	Hedgehog protein
3	9544.ENSMMUP00000020624	0.892	Protein Wnt
4	9544.ENSMMUP00000006513	0.883	Wingless-type MMTV integration site family, member 3A
5	9544.ENSMMUP00000013059	0.846	Ligand for members of the frizzled family of seven transmembrane receptors
6	9544.ENSMMUP00000005761	0.808	Notum pectinacetylesterase homolog (Drosophila)
7	9544.ENSMMUP00000003548	0.800	Patched 1
8	9544.ENSMMUP00000020577	0.800	Insulin like growth factor 2
9	9544.ENSMMUP00000028609	0.793	Protein Wnt
10	9544.ENSMMUP00000009729	0.771	Fibroblast growth factor 2 (basic)
11	9544.ENSMMUP00000035422	0.765	Sulfotransferase
12	9544.ENSMMUP00000005106	0.754	Alpha-fetoprotein
13	9544.ENSMMUP00000011329	0.753	Belongs to the glycosyltransferase 47 family.
14	9544.ENSMMUP00000030257	0.747	N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 2
15	9544.ENSMMUP00000028143	0.744	D-glucuronyl C5-epimerase
16	9544.ENSMMUP00000027394	0.738	Protein Wnt
17	9544.ENSMMUP00000005611	0.735	Heparan-sulfate 6-O-sulfotransferase
18	9544.ENSMMUP00000003853	0.730	N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4
19	9544.ENSMMUP00000020007	0.730	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3
20	9544.ENSMMUP00000033848	0.730	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:2000050	0.993	regulation of non-canonical Wnt signaling pathway
GO:0060828	0.989	regulation of canonical Wnt signaling pathway
GO:0009967	0.987	positive regulation of signal transduction
GO:0032502	0.986	developmental process
GO:0030177	0.901	positive regulation of Wnt signaling pathway
GO:0009987	0.889	cellular process
GO:0050896	0.881	response to stimulus
GO:0022603	0.853	regulation of anatomical structure morphogenesis
GO:0048856	0.841	anatomical structure development
GO:2000027	0.829	regulation of animal organ morphogenesis
GO:0048519	0.715	negative regulation of biological process
GO:0048523	0.714	negative regulation of cellular process
GO:0009653	0.710	anatomical structure morphogenesis
GO:0090090	0.690	negative regulation of canonical Wnt signaling pathway
GO:0090175	0.630	regulation of establishment of planar polarity
GO:0032501	0.547	multicellular organismal process
GO:0007275	0.543	multicellular organism development
GO:0048731	0.427	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.998	endomembrane system
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0043233	0.995	organelle lumen
GO:0070013	0.994	intracellular organelle lumen
GO:0005794	0.922	Golgi apparatus
GO:0005576	0.730	extracellular region
GO:0005796	0.675	Golgi lumen
GO:0005773	0.623	vacuole
GO:0005783	0.544	endoplasmic reticulum
GO:0000323	0.543	lytic vacuole
GO:0005764	0.508	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]