StarFunc result for job id P51671

User Input

>input (97 residues)
MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK
AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51671	1.000	1.000	7.910E-19	97	1.000	1.000	P51671.pdb.gz	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
2	AFDB:P13500	0.780	0.767	2.466E-14	99	0.711	0.697	P13500.pdb.gz	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
3	AFDB:P80075	0.713	0.699	4.237E-14	99	0.701	0.687	P80075.pdb.gz	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
4	AFDB:P48298	0.870	0.870	8.332E-14	97	0.588	0.588	P48298.pdb.gz	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
5	AFDB:P80098	0.825	0.810	8.915E-14	99	0.701	0.687	P80098.pdb.gz	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
6	AFDB:D4ABS1	0.713	0.709	1.876E-13	98	0.629	0.622	D4ABS1.pdb.gz	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
7	AFDB:Q99616	0.802	0.795	3.437E-12	98	0.619	0.612	Q99616.pdb.gz	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
8	AFDB:Q62401	0.700	0.654	1.522E-11	104	0.464	0.433	Q62401.pdb.gz	CCL12_MOUSE C-C motif chemokine 12 OS=Mus musculus OX=10090 GN=Ccl12 PE=2 SV=1
9	AFDB:Q9Z121	0.774	0.774	1.522E-11	97	0.495	0.495	Q9Z121.pdb.gz	CCL8_MOUSE C-C motif chemokine 8 OS=Mus musculus OX=10090 GN=Ccl8 PE=3 SV=1
10	AFDB:P10148	0.729	0.508	1.628E-11	148	0.474	0.311	P10148.pdb.gz	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
11	PDB:2mpmA	0.577	0.724	8.430E-11	74	0.763	1.000	2mpmA.pdb.gz	Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
12	PDB:1esrA	0.636	0.804	3.260E-10	76	0.454	0.579	1esrA.pdb.gz
13	PDB:1domA	0.647	0.813	3.981E-9	76	0.505	0.645	1domA.pdb.gz
14	PDB:2ra4B	0.615	0.893	5.974E-9	65	0.412	0.615	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
15	PDB:1bo0A	0.590	0.733	6.839E-9	76	0.485	0.618	1bo0A.pdb.gz
16	PDB:4zltF	0.579	0.880	5.185E-7	62	0.299	0.468	4zltF.pdb.gz
17	PDB:5yamA	0.589	0.798	3.009E-6	69	0.268	0.377	5yamA.pdb.gz
18	PDB:7f1tA	0.606	0.145	3.445E-6	423	0.268	0.061	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
19	PDB:2q8tB	0.601	0.883	4.515E-6	65	0.237	0.354	2q8tB.pdb.gz
20	PDB:1nr4E	0.635	0.873	5.169E-6	69	0.227	0.319	1nr4E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51671	9.51e-67	197	97	1.000	1.000	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
2	P48298	2.14e-38	125	97	0.588	0.588	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
3	Q99616	3.64e-38	125	98	0.649	0.643	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
4	P13500	2.50e-37	122	99	0.711	0.697	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
5	P80075	6.92e-37	121	99	0.701	0.687	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
6	P80098	7.45e-35	116	99	0.567	0.556	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
7	Q62401	5.20e-34	114	104	0.577	0.538	CCL12_MOUSE C-C motif chemokine 12 OS=Mus musculus OX=10090 GN=Ccl12 PE=2 SV=1
8	P97545	5.44e-33	112	97	0.515	0.515	CCL11_RAT Eotaxin OS=Rattus norvegicus OX=10116 GN=Ccl11 PE=3 SV=1
9	D4ABS1	7.21e-33	111	98	0.536	0.531	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
10	Q9Z121	3.02e-30	105	97	0.505	0.505	CCL8_MOUSE C-C motif chemokine 8 OS=Mus musculus OX=10090 GN=Ccl8 PE=3 SV=1
11	P14844	2.89e-28	101	148	0.485	0.318	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
12	P10148	4.05e-28	101	148	0.495	0.324	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
13	Q9QXY8	6.67e-28	99.0	97	0.485	0.485	CCL7_RAT C-C motif chemokine 7 OS=Rattus norvegicus OX=10116 GN=Ccl7 PE=3 SV=1
14	Q03366	1.47e-22	85.5	97	0.557	0.557	CCL7_MOUSE C-C motif chemokine 7 OS=Mus musculus OX=10090 GN=Ccl7 PE=3 SV=1
15	P13236	9.05e-17	70.9	92	0.381	0.402	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
16	P16619	3.95e-16	68.9	93	0.381	0.398	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
17	P30882	7.96e-16	68.2	91	0.381	0.407	CCL5_MOUSE C-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Ccl5 PE=1 SV=2
18	O00175	5.20e-15	67.0	119	0.361	0.294	CCL24_HUMAN C-C motif chemokine 24 OS=Homo sapiens OX=9606 GN=CCL24 PE=1 SV=2
19	P10147	1.51e-14	65.1	92	0.371	0.391	CCL3_HUMAN C-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CCL3 PE=1 SV=1
20	P50230	2.09e-14	64.7	92	0.371	0.391	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	4.3e-18	76.5	Small cytokines (intecrine/chemokine), interleukin-8 like
2	PF00335 Tetraspanin	1.8e+02	13.2	Tetraspanin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302234

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441600	0.999	C-C chemokine receptor type 3
2	9606.ENSP00000362795	0.995	C-X-C chemokine receptor type 3
3	9606.ENSP00000305651	0.991	C-X-C motif chemokine 10
4	9606.ENSP00000292303	0.986	C-C chemokine receptor type 5
5	9606.ENSP00000292301	0.969	C-C chemokine receptor type 2
6	9606.ENSP00000379140	0.969	Stromal cell-derived factor 1
7	9606.ENSP00000231454	0.960	Interleukin-5
8	9606.ENSP00000300134	0.959	Signal transducer and activator of transcription 6
9	9606.ENSP00000386884	0.946	C-X-C chemokine receptor type 4
10	9606.ENSP00000263025	0.929	Mitogen-activated protein kinase 3
11	9606.ENSP00000368683	0.920	Endothelin-1
12	9606.ENSP00000305372	0.917	Beta-2 adrenergic receptor
13	9606.ENSP00000362680	0.912	Proto-oncogene tyrosine-protein kinase Src
14	9606.ENSP00000482259	0.912	C-C motif chemokine 4
15	9606.ENSP00000302486	0.911	Dual specificity mitogen-activated protein kinase kinase 1
16	9606.ENSP00000306490	0.911	Muscarinic acetylcholine receptor M1
17	9606.ENSP00000385523	0.911	Peroxisome proliferator-activated receptor alpha
18	9606.ENSP00000308541	0.908	Prothrombin
19	9606.ENSP00000215832	0.906	Mitogen-activated protein kinase 1
20	9606.ENSP00000286548	0.906	Guanine nucleotide-binding protein G(q) subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	0.999	chemokine activity
GO:0048020	0.996	CCR chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.995	cellular process
GO:0051716	0.989	cellular response to stimulus
GO:0048522	0.985	positive regulation of cellular process
GO:0042221	0.982	response to chemical
GO:0040011	0.979	locomotion
GO:0040012	0.979	regulation of locomotion
GO:0007165	0.978	signal transduction
GO:0009605	0.977	response to external stimulus
GO:2000145	0.967	regulation of cell motility
GO:0060326	0.966	cell chemotaxis
GO:0071840	0.962	cellular component organization or biogenesis
GO:0030595	0.961	leukocyte chemotaxis
GO:0006950	0.955	response to stress
GO:0006952	0.903	defense response
GO:0016043	0.896	cellular component organization
GO:0030334	0.847	regulation of cell migration
GO:0050793	0.813	regulation of developmental process
GO:0006955	0.744	immune response
GO:0044419	0.682	biological process involved in interspecies interaction between organisms
GO:0009607	0.679	response to biotic stimulus
GO:0071674	0.672	mononuclear cell migration
GO:0051707	0.670	response to other organism
GO:0097529	0.662	myeloid leukocyte migration
GO:0048583	0.660	regulation of response to stimulus
GO:0051128	0.660	regulation of cellular component organization
GO:0040017	0.636	positive regulation of locomotion
GO:0007010	0.627	cytoskeleton organization
GO:0022603	0.620	regulation of anatomical structure morphogenesis
GO:0042127	0.590	regulation of cell population proliferation
GO:0071621	0.584	granulocyte chemotaxis
GO:2000147	0.549	positive regulation of cell motility
GO:0065008	0.546	regulation of biological quality
GO:0065009	0.529	regulation of molecular function
GO:0030335	0.527	positive regulation of cell migration
GO:0048519	0.523	negative regulation of biological process
GO:0006954	0.504	inflammatory response
GO:0032501	0.490	multicellular organismal process
GO:0022604	0.489	regulation of cell morphogenesis
GO:0008360	0.483	regulation of cell shape
GO:1902903	0.481	regulation of supramolecular fiber organization
GO:0010033	0.472	response to organic substance
GO:0048584	0.464	positive regulation of response to stimulus
GO:0048523	0.461	negative regulation of cellular process
GO:0002682	0.448	regulation of immune system process
GO:0008284	0.434	positive regulation of cell population proliferation
GO:0006959	0.432	humoral immune response
GO:0042592	0.428	homeostatic process
GO:0019222	0.427	regulation of metabolic process
GO:0048878	0.420	chemical homeostasis
GO:0048856	0.414	anatomical structure development
GO:0030003	0.408	intracellular monoatomic cation homeostasis
GO:0071310	0.395	cellular response to organic substance
GO:0098542	0.392	defense response to other organism
GO:0051239	0.387	regulation of multicellular organismal process
GO:0061844	0.376	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0002684	0.372	positive regulation of immune system process
GO:0071704	0.352	organic substance metabolic process
GO:0032101	0.341	regulation of response to external stimulus
GO:0032103	0.332	positive regulation of response to external stimulus
GO:0060255	0.329	regulation of macromolecule metabolic process
GO:0009893	0.312	positive regulation of metabolic process
GO:0002685	0.307	regulation of leukocyte migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005615	0.832	extracellular space
GO:0071944	0.563	cell periphery
GO:0005886	0.484	plasma membrane
GO:0043231	0.303	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]