StarFunc result for job id P51688

User Input

>input (502 residues)
MSCPVPACCALLLVLGLCRARPRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLF
RNAFTSVSSCSPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGI
IGKKHVGPETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDP
HRCGHSQPQYGTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQY
TTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPE
HPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWAT
VFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQP
TGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWV
CAPDGVLEEKLSPQCQPLHNEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51688	1.000	1.000	0.000	502	1.000	1.000	P51688.pdb.gz	SPHM_HUMAN N-sulphoglucosamine sulphohydrolase OS=Homo sapiens OX=9606 GN=SGSH PE=1 SV=1
2	AFDB:A1L3T3	0.972	0.972	6.725E-102	502	0.888	0.888	A1L3T3.pdb.gz	A1L3T3_MOUSE N-sulfoglucosamine sulfohydrolase (Sulfamidase) OS=Mus musculus OX=10090 GN=Sgsh PE=2 SV=1
3	AFDB:B1ATE0	0.529	0.627	1.416E-43	422	0.450	0.536	B1ATE0.pdb.gz	B1ATE0_MOUSE N-sulfoglucosamine sulfohydrolase (sulfamidase) OS=Mus musculus OX=10090 GN=Sgsh PE=1 SV=1
4	AFDB:Q6MX51	0.743	0.799	6.352E-33	465	0.237	0.256	Q6MX51.pdb.gz	Q6MX51_MYCTU Probable sulfatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=atsG PE=1 SV=1
5	AFDB:Q45087	0.634	0.620	1.023E-24	514	0.207	0.202	Q45087.pdb.gz	BCPMH_TRICW Multifunctional alkaline phosphatase superfamily protein PehA OS=Trinickia caryophylli OX=28094 GN=pehA PE=1 SV=1
6	AFDB:P15289	0.641	0.635	9.616E-24	507	0.249	0.247	P15289.pdb.gz	ARSA_HUMAN Arylsulfatase A OS=Homo sapiens OX=9606 GN=ARSA PE=1 SV=3
7	PDB:4cysA	0.614	0.580	9.847E-24	534	0.261	0.245	4cysA.pdb.gz	Evolutionary repurposing of a sulfatase: A new Michaelis complex leads to efficient transition state charge offset.
8	AFDB:Q6UWY0	0.540	0.507	2.553E-23	536	0.185	0.174	Q6UWY0.pdb.gz	ARSK_HUMAN Arylsulfatase K OS=Homo sapiens OX=9606 GN=ARSK PE=1 SV=1
9	AFDB:Q32KK2	0.643	0.637	3.212E-23	507	0.249	0.247	Q32KK2.pdb.gz	Q32KK2_RAT Arylsulfatase A OS=Rattus norvegicus OX=10116 GN=Arsa PE=3 SV=1
10	AFDB:Q9VZP8	0.615	0.604	6.043E-23	512	0.221	0.217	Q9VZP8.pdb.gz	Q9VZP8_DROME Iduronate 2-sulfatase OS=Drosophila melanogaster OX=7227 GN=Ids PE=1 SV=1
11	AFDB:P51691	0.606	0.571	7.604E-23	536	0.255	0.239	P51691.pdb.gz	ARS_PSEAE Arylsulfatase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=atsA PE=1 SV=3
12	PDB:1n2lA	0.620	0.642	1.952E-22	483	0.237	0.246	1n2lA.pdb.gz	Crystal structure of a covalent intermediate of endogenous human arylsulfatase A.
13	PDB:1fsuA	0.598	0.629	6.127E-21	475	0.207	0.219	1fsuA.pdb.gz	Structure of a human lysosomal sulfatase.
14	PDB:4fdiA	0.593	0.602	7.279E-21	494	0.247	0.251	4fdiA.pdb.gz	The Structure of Human GALNS Reveals the Molecular Basis for Mucopolysaccharidosis IV A.
15	PDB:2w8sB	0.617	0.605	1.450E-20	513	0.209	0.205	2w8sB.pdb.gz	An Efficient, Multiply Promiscuous Hydrolase in the Alkaline Phosphatase Superfamily.
16	PDB:5fqlA	0.575	0.570	1.083E-19	507	0.213	0.211	5fqlA.pdb.gz	Insights into Hunter syndrome from the structure of iduronate-2-sulfatase.
17	PDB:1p49A	0.589	0.542	1.706E-18	549	0.203	0.186	1p49A.pdb.gz	Structure of Human Estrone Sulfatase Suggests Functional Roles of Membrane Association
18	PDB:6xlpA	0.496	0.430	5.559E-13	586	0.133	0.114	6xlpA.pdb.gz	Structure of the essential inner membrane lipopolysaccharide-PbgA complex.
19	PDB:5venA	0.392	0.504	8.627E-9	382	0.102	0.134	5venA.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
20	PDB:5vemB	0.372	0.474	1.447E-8	383	0.110	0.144	5vemB.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L3T3	0.0	941	502	0.888	0.888	A1L3T3_MOUSE N-sulfoglucosamine sulfohydrolase (Sulfamidase) OS=Mus musculus OX=10090 GN=Sgsh PE=2 SV=1
2	P51688	0.0	1042	502	1.000	1.000	SPHM_HUMAN N-sulphoglucosamine sulphohydrolase OS=Homo sapiens OX=9606 GN=SGSH PE=1 SV=1
3	Q3URR4	0.0	928	493	0.875	0.890	Q3URR4_MOUSE N-sulfoglucosamine sulfohydrolase (Fragment) OS=Mus musculus OX=10090 GN=Sgsh PE=2 SV=1
4	Q9EQ07	0.0	938	502	0.884	0.884	Q9EQ07_MOUSE Mutant heparan N-sulfatase OS=Mus musculus OX=10090 GN=Sgsh PE=2 SV=1
5	Q9EQ08	0.0	940	502	0.886	0.886	Q9EQ08_MOUSE Heparan N-sulfatase OS=Mus musculus OX=10090 GN=Sgsh PE=1 SV=1
6	Q9JHK6	0.0	933	502	0.880	0.880	Q9JHK6_MOUSE N-sulfoglucosamine sulfohydrolase OS=Mus musculus OX=10090 GN=Sgsh PE=2 SV=1
7	Q6ZQM7	4.50e-161	465	422	0.440	0.524	Q6ZQM7_MOUSE cDNA fis, clone TRACH3001759, highly similar to Mus musculus N-sulfoglucosamine sulfohydrolase (sulfamidase) OS=Mus musculus OX=10090 GN=Sgsh PE=2 SV=1
8	B1ATE0	8.17e-160	462	422	0.436	0.519	B1ATE0_MOUSE N-sulfoglucosamine sulfohydrolase (sulfamidase) OS=Mus musculus OX=10090 GN=Sgsh PE=1 SV=1
9	Q6MX51	6.04e-34	135	465	0.241	0.260	Q6MX51_MYCTU Probable sulfatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=atsG PE=1 SV=1
10	P51691	4.83e-21	98.6	536	0.285	0.267	ARS_PSEAE Arylsulfatase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=atsA PE=1 SV=3
11	P50428	9.08e-20	94.4	506	0.295	0.292	ARSA_MOUSE Arylsulfatase A OS=Mus musculus OX=10090 GN=Arsa PE=1 SV=2
12	Q32KK2	1.45e-19	94.0	507	0.297	0.294	Q32KK2_RAT Arylsulfatase A OS=Rattus norvegicus OX=10116 GN=Arsa PE=3 SV=1
13	P34059	4.25e-19	92.4	522	0.229	0.220	GALNS_HUMAN N-acetylgalactosamine-6-sulfatase OS=Homo sapiens OX=9606 GN=GALNS PE=1 SV=1
14	Q3KR80	3.97e-18	89.4	497	0.217	0.219	Q3KR80_RAT Arylsulfatase A OS=Rattus norvegicus OX=10116 GN=Arsa PE=2 SV=1
15	P15289	3.55e-17	86.3	507	0.211	0.209	ARSA_HUMAN Arylsulfatase A OS=Homo sapiens OX=9606 GN=ARSA PE=1 SV=3
16	Q571E4	5.15e-17	85.9	520	0.213	0.206	GALNS_MOUSE N-acetylgalactosamine-6-sulfatase OS=Mus musculus OX=10090 GN=Galns PE=1 SV=2
17	Q45087	2.50e-16	84.0	514	0.235	0.230	BCPMH_TRICW Multifunctional alkaline phosphatase superfamily protein PehA OS=Trinickia caryophylli OX=28094 GN=pehA PE=1 SV=1
18	Q9C0V7	8.65e-15	79.3	554	0.261	0.236	YHJ2_SCHPO Uncharacterized sulfatase PB10D8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPB10D8.02c PE=3 SV=1
19	Q9VEX0	1.78e-14	79.0	1114	0.181	0.082	SULF1_DROME Extracellular sulfatase SULF-1 homolog OS=Drosophila melanogaster OX=7227 GN=Sulf1 PE=1 SV=1
20	P15848	2.68e-14	77.4	533	0.167	0.158	ARSB_HUMAN Arylsulfatase B OS=Homo sapiens OX=9606 GN=ARSB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07394 DUF1501	94	13.6	Protein of unknown function (DUF1501)
2	PF02995 DUF229	88	13.2	Protein of unknown function (DUF229)
3	PF16347 DUF4976	7.4e-06	37.5	Domain of unknown function (DUF4976)
4	PF01663 Phosphodiest	0.00053	31.3	Type I phosphodiesterase / nucleotide pyrophosphatase
5	PF00884 Sulfatase	4.2e-54	195.6	Sulfatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314606

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368965	0.974	Heparan-alpha-glucosaminide N-acetyltransferase
2	9606.ENSP00000247933	0.970	Alpha-L-iduronidase
3	9606.ENSP00000272902	0.923	Sulfatase-modifying factor 1
4	9606.ENSP00000225927	0.914	Alpha-N-acetylglucosaminidase
5	9606.ENSP00000226578	0.829	Beta-mannosidase
6	9606.ENSP00000249806	0.829	CLN6, transmembrane ER protein
7	9606.ENSP00000366673	0.824	Ceroid-lipofuscinosis neuronal protein 5
8	9606.ENSP00000394863	0.817	Palmitoyl-protein thioesterase 1
9	9606.ENSP00000355384	0.748	Sodium-independent sulfate anion transporter
10	9606.ENSP00000295759	0.741	Beta-galactosidase-1-like protein
11	9606.ENSP00000234488	0.726	Chloride transport protein 6
12	9606.ENSP00000442050	0.659	Ethanolamine-phosphate cytidylyltransferase
13	9606.ENSP00000000412	0.657	Cation-dependent mannose-6-phosphate receptor
14	9606.ENSP00000464087	0.641	E3 ubiquitin-protein ligase RNF213
15	9606.ENSP00000379891	0.638	AP-1 complex subunit sigma-3
16	9606.ENSP00000347408	0.620	AP-3 complex subunit mu-1
17	9606.ENSP00000341938	0.615	Sulfatase-modifying factor 2
18	9606.ENSP00000216366	0.604	AP-4 complex subunit sigma-1
19	9606.ENSP00000296468	0.598	Major facilitator superfamily domain-containing protein 8
20	9606.ENSP00000269051	0.590	Rhomboid-related protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016250	1.000	N-sulfoglucosamine sulfohydrolase activity
GO:0008484	1.000	sulfuric ester hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006790	0.997	sulfur compound metabolic process
GO:0044248	0.996	cellular catabolic process
GO:0006029	0.996	proteoglycan metabolic process
GO:0044273	0.993	sulfur compound catabolic process
GO:0006516	0.992	glycoprotein catabolic process
GO:0030203	0.662	glycosaminoglycan metabolic process
GO:0006027	0.609	glycosaminoglycan catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043202	0.999	lysosomal lumen
GO:0031982	0.956	vesicle
GO:0005576	0.942	extracellular region
GO:0012505	0.932	endomembrane system
GO:0005615	0.861	extracellular space
GO:1903561	0.805	extracellular vesicle
GO:0070062	0.804	extracellular exosome
GO:0016020	0.483	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17881	1.000	H2O + N-sulfo-D-glucosamine = D-glucosamine + sulfate
EC:3.10.1.1	1.000	N-sulfoglucosamine sulfohydrolase.
EC:3.1.6.-	1.000	Sulfuric ester hydrolases.

[back to server]