StarFunc result for job id P51692

User Input

>input (787 residues)
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG
GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384N5W4	0.895	0.887	0.000	794	0.928	0.919	A0A384N5W4.pdb.gz	A0A384N5W4_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=2 SV=1
2	AFDB:K7EK35	0.859	0.886	1.250E-97	763	0.891	0.919	K7EK35.pdb.gz	K7EK35_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=1 SV=1
3	AFDB:C0SPC8	0.920	0.922	3.502E-97	785	0.787	0.789	C0SPC8.pdb.gz
4	AFDB:A0A286Y960	0.638	0.661	2.723E-55	758	0.355	0.368	A0A286Y960.pdb.gz
5	AFDB:Q1KQ07	0.636	0.596	7.296E-55	841	0.377	0.353	Q1KQ07.pdb.gz	Q1KQ07_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat6 PE=2 SV=1
6	AFDB:W5UJB3	0.688	0.699	1.494E-54	773	0.353	0.360	W5UJB3.pdb.gz	W5UJB3_ICTPU Signal transducer and activator of transcription OS=Ictalurus punctatus OX=7998 GN=STAT6 PE=2 SV=1
7	AFDB:H0YJH6	0.593	0.540	4.302E-53	865	0.370	0.336	H0YJH6.pdb.gz	H0YJH6_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT6 PE=1 SV=2
8	AFDB:Q24151	0.665	0.686	9.310E-46	761	0.305	0.315	Q24151.pdb.gz	STAT_DROME Signal transducer and transcription activator OS=Drosophila melanogaster OX=7227 GN=Stat92E PE=1 SV=1
9	AFDB:P40763	0.774	0.790	2.302E-43	770	0.292	0.299	P40763.pdb.gz	STAT3_HUMAN Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=2
10	AFDB:C0SPC7	0.765	0.748	7.718E-43	806	0.307	0.300	C0SPC7.pdb.gz
11	PDB:1yvlB	0.688	0.819	2.505E-38	653	0.262	0.315	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
12	PDB:6wczA	0.369	0.788	7.928E-12	350	0.119	0.269	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
13	PDB:2zxcA	0.105	0.125	4.057E-2	643	0.015	0.019	2zxcA.pdb.gz	Mechanistic insights into the hydrolysis and synthesis of ceramide by neutral ceramidase.
14	PDB:7tysA	0.100	0.186	4.853E-2	361	0.041	0.089	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
15	PDB:3oaiA	0.089	0.131	7.596E-2	488	0.019	0.031	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
16	PDB:6wvdA	0.089	0.134	1.039E-1	397	0.042	0.083	6wvdA.pdb.gz
17	PDB:6ta5D	0.057	0.122	1.422E-1	345	0.041	0.093	6ta5D.pdb.gz
18	PDB:4wrnB	0.082	0.095	1.556E-1	663	0.022	0.026	4wrnB.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
19	PDB:1xl6A	0.103	0.223	1.861E-1	291	0.033	0.089	1xl6A.pdb.gz
20	PDB:5fl1A	0.058	0.064	2.035E-1	703	0.037	0.041	5fl1A.pdb.gz	Analysis of transition state mimicry by tight binding aminothiazoline inhibitors provides insight into catalysis by humanO-GlcNAcase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384N5W4	0.0	1506	794	0.929	0.921	A0A384N5W4_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=2 SV=1
2	K7EIF9	0.0	1258	658	0.778	0.930	K7EIF9_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=1 SV=3
3	K7EK35	0.0	1429	763	0.891	0.919	K7EK35_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT5A PE=1 SV=1
4	P42229	0.0	1506	794	0.929	0.921	STA5A_HUMAN Signal transducer and activator of transcription 5A OS=Homo sapiens OX=9606 GN=STAT5A PE=1 SV=1
5	P42230	0.0	1478	793	0.910	0.903	STA5A_MOUSE Signal transducer and activator of transcription 5A OS=Mus musculus OX=10090 GN=Stat5a PE=1 SV=1
6	P42232	0.0	1590	786	0.968	0.969	STA5B_MOUSE Signal transducer and activator of transcription 5B OS=Mus musculus OX=10090 GN=Stat5b PE=1 SV=1
7	P51692	0.0	1638	787	1.000	1.000	STA5B_HUMAN Signal transducer and activator of transcription 5B OS=Homo sapiens OX=9606 GN=STAT5B PE=1 SV=2
8	P52632	0.0	1593	786	0.968	0.969	STA5B_RAT Signal transducer and activator of transcription 5B OS=Rattus norvegicus OX=10116 GN=Stat5b PE=1 SV=1
9	Q62771	0.0	1484	793	0.912	0.905	STA5A_RAT Signal transducer and activator of transcription 5A OS=Rattus norvegicus OX=10116 GN=Stat5a PE=1 SV=1
10	Q68SP3	0.0	1280	785	0.793	0.795	Q68SP3_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=stat5.1 PE=1 SV=1
11	Q9DG74	0.0	1282	784	0.792	0.795	Q9DG74_ONCMY Signal transducer and activator of transcription OS=Oncorhynchus mykiss OX=8022 GN=STAT5 PE=2 SV=1
12	Q9JIA0	0.0	1478	793	0.910	0.903	Q9JIA0_MOUSE Signal transducer and activator of transcription OS=Mus musculus OX=10090 GN=Stat5a PE=1 SV=2
13	Q9R0X9	1.75e-159	464	230	0.285	0.974	Q9R0X9_MOUSE Mammary gland factor STAT5A (Fragment) OS=Mus musculus OX=10090 GN=STAT5A PE=4 SV=1
14	P52633	1.15e-155	476	837	0.380	0.357	STAT6_MOUSE Signal transducer and transcription activator 6 OS=Mus musculus OX=10090 GN=Stat6 PE=1 SV=2
15	E5F1H4	3.47e-155	475	847	0.385	0.358	E5F1H4_PIG Signal transducer and activator of transcription OS=Sus scrofa OX=9823 GN=STAT6 PE=2 SV=1
16	E1U8C5	1.23e-154	474	848	0.385	0.357	E1U8C5_PIG Signal transducer and activator of transcription OS=Sus scrofa OX=9823 GN=stat6 PE=2 SV=1
17	Q1KQ07	1.10e-153	471	841	0.371	0.347	Q1KQ07_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat6 PE=2 SV=1
18	P42226	2.00e-152	468	847	0.388	0.360	STAT6_HUMAN Signal transducer and activator of transcription 6 OS=Homo sapiens OX=9606 GN=STAT6 PE=1 SV=1
19	A0A0G2K2M3	2.89e-150	462	852	0.371	0.343	A0A0G2K2M3_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat6 PE=1 SV=1
20	H0YJH6	4.89e-148	457	865	0.388	0.353	H0YJH6_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	9.6e-09	46.5	SH2 domain
2	PF01017 STAT_alpha	1.5e-43	160.2	STAT protein, all-alpha domain
3	PF02864 STAT_bind	6.2e-50	180.7	STAT protein, DNA binding domain
4	PF02865 STAT_int	1.3e-37	140.3	STAT protein, protein interaction domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293328

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371067	0.999	Tyrosine-protein kinase JAK2
2	9606.ENSP00000391676	0.999	Tyrosine-protein kinase JAK3
3	9606.ENSP00000275493	0.998	Epidermal growth factor receptor
4	9606.ENSP00000343204	0.997	Tyrosine-protein kinase JAK1
5	9606.ENSP00000342235	0.995	Receptor tyrosine-protein kinase erbB-4
6	9606.ENSP00000226730	0.994	Interleukin-2
7	9606.ENSP00000222139	0.993	Erythropoietin receptor
8	9606.ENSP00000346300	0.989	Crk-like protein
9	9606.ENSP00000369293	0.989	Interleukin-2 receptor subunit alpha
10	9606.ENSP00000483403	0.988	Growth hormone receptor
11	9606.ENSP00000243346	0.983	N-myc-interactor
12	9606.ENSP00000481249	0.981	Suppressor of cytokine signaling 2
13	9606.ENSP00000263253	0.980	Histone acetyltransferase p300
14	9606.ENSP00000231509	0.979	Glucocorticoid receptor
15	9606.ENSP00000252723	0.979	Erythropoietin
16	9606.ENSP00000330341	0.975	Suppressor of cytokine signaling 3
17	9606.ENSP00000409346	0.974	Cytokine-inducible SH2-containing protein
18	9606.ENSP00000431885	0.974	Non-receptor tyrosine-protein kinase TYK2
19	9606.ENSP00000296871	0.973	Granulocyte-macrophage colony-stimulating factor
20	9606.ENSP00000216223	0.972	Interleukin-2 receptor subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0003677	0.999	DNA binding
GO:0043565	0.966	sequence-specific DNA binding
GO:0019899	0.885	enzyme binding
GO:0005102	0.773	signaling receptor binding
GO:0042802	0.740	identical protein binding
GO:0008134	0.651	transcription factor binding
GO:0003690	0.549	double-stranded DNA binding
GO:0061629	0.369	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019901	0.356	protein kinase binding
GO:1990837	0.352	sequence-specific double-stranded DNA binding
GO:0000981	0.302	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.988	positive regulation of biological process
GO:0051239	0.987	regulation of multicellular organismal process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0007259	0.986	receptor signaling pathway via JAK-STAT
GO:0010468	0.984	regulation of gene expression
GO:0048522	0.982	positive regulation of cellular process
GO:0009893	0.977	positive regulation of metabolic process
GO:0031326	0.977	regulation of cellular biosynthetic process
GO:0019219	0.977	regulation of nucleobase-containing compound metabolic process
GO:0002682	0.973	regulation of immune system process
GO:0010604	0.973	positive regulation of macromolecule metabolic process
GO:0010033	0.969	response to organic substance
GO:0006357	0.968	regulation of transcription by RNA polymerase II
GO:0045637	0.960	regulation of myeloid cell differentiation
GO:0048583	0.952	regulation of response to stimulus
GO:0045597	0.943	positive regulation of cell differentiation
GO:0032501	0.936	multicellular organismal process
GO:0032502	0.934	developmental process
GO:0001775	0.922	cell activation
GO:0048856	0.916	anatomical structure development
GO:0051173	0.914	positive regulation of nitrogen compound metabolic process
GO:0031325	0.914	positive regulation of cellular metabolic process
GO:0071310	0.909	cellular response to organic substance
GO:0030097	0.906	hemopoiesis
GO:0002376	0.890	immune system process
GO:0042127	0.890	regulation of cell population proliferation
GO:0009891	0.875	positive regulation of biosynthetic process
GO:0008284	0.866	positive regulation of cell population proliferation
GO:0010557	0.866	positive regulation of macromolecule biosynthetic process
GO:1901700	0.864	response to oxygen-containing compound
GO:0071704	0.863	organic substance metabolic process
GO:0019221	0.856	cytokine-mediated signaling pathway
GO:0045944	0.856	positive regulation of transcription by RNA polymerase II
GO:0044238	0.848	primary metabolic process
GO:0048519	0.843	negative regulation of biological process
GO:0044237	0.840	cellular metabolic process
GO:0010243	0.832	response to organonitrogen compound
GO:0051240	0.827	positive regulation of multicellular organismal process
GO:1901652	0.819	response to peptide
GO:0009719	0.806	response to endogenous stimulus
GO:0048523	0.805	negative regulation of cellular process
GO:0006807	0.794	nitrogen compound metabolic process
GO:0043434	0.783	response to peptide hormone
GO:0043170	0.782	macromolecule metabolic process
GO:1901701	0.750	cellular response to oxygen-containing compound
GO:0007275	0.743	multicellular organism development
GO:0060416	0.742	response to growth hormone
GO:0002521	0.738	leukocyte differentiation
GO:0048513	0.735	animal organ development
GO:0014070	0.735	response to organic cyclic compound
GO:0045646	0.726	regulation of erythrocyte differentiation
GO:0071495	0.721	cellular response to endogenous stimulus
GO:0046649	0.710	lymphocyte activation
GO:0048584	0.700	positive regulation of response to stimulus
GO:0003006	0.697	developmental process involved in reproduction
GO:0051179	0.688	localization
GO:0065008	0.688	regulation of biological quality
GO:0090304	0.683	nucleic acid metabolic process
GO:0050878	0.680	regulation of body fluid levels
GO:1903131	0.679	mononuclear cell differentiation
GO:0032870	0.673	cellular response to hormone stimulus
GO:0042592	0.671	homeostatic process
GO:0048732	0.665	gland development
GO:1901699	0.663	cellular response to nitrogen compound
GO:0051234	0.654	establishment of localization
GO:0030879	0.645	mammary gland development
GO:0048731	0.625	system development
GO:0006810	0.624	transport
GO:0045639	0.617	positive regulation of myeloid cell differentiation
GO:0030099	0.593	myeloid cell differentiation
GO:0030098	0.569	lymphocyte differentiation
GO:1901576	0.568	organic substance biosynthetic process
GO:0044249	0.568	cellular biosynthetic process
GO:0007595	0.568	lactation
GO:0010467	0.559	gene expression
GO:0034101	0.513	erythrocyte homeostasis
GO:0006950	0.432	response to stress
GO:0009605	0.402	response to external stimulus
GO:1901564	0.345	organonitrogen compound metabolic process
GO:0010646	0.334	regulation of cell communication
GO:0040007	0.333	growth
GO:0023051	0.333	regulation of signaling
GO:0009892	0.333	negative regulation of metabolic process
GO:0030218	0.311	erythrocyte differentiation
GO:0010941	0.304	regulation of cell death
GO:0080134	0.300	regulation of response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.998	nucleoplasm
GO:0071944	0.438	cell periphery
GO:0016020	0.362	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]