StarFunc result for job id P51784

User Input

>input (963 residues)
MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRRERTAMATVAANPAAAAAAVAA
AAAVTEDREPQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGG
DQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIE
RKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDT
RLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE
DFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAE
AYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVK
KKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDP
FCYLSVPLPISHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERM
MVADVFSHRFYKLYQLEEPLSSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPA
RDYNNSYYGLMLFGHPLLVSVPRDRFTWEGLYNVLMYRLSRYVTKPNSDDEDDGDEKEDD
EEDKDDVPGPSTGGSLRDPEPEQAGPSSGVTNRCPFLLDNCLGTSQWPPRRRRKQLFTLQ
TVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVMKKAPVR
LQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREK
LDTLVEFPIRDLDFSEFVIQPQNESNPELYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQ
WHYFDDNSVSPVNENQIESKAAYVLFYQRQDVARRLLSPAGSSGAPASPACSSPPSSEFM
DVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2X6	0.536	0.562	0.000	916	0.454	0.477	A0A024R2X6.pdb.gz
2	AFDB:A1LPW7	0.555	0.555	0.000	963	0.457	0.457	A1LPW7.pdb.gz
3	AFDB:E7EZD6	0.542	0.518	0.000	1009	0.454	0.433	E7EZD6.pdb.gz	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
4	AFDB:P51784	1.000	1.000	0.000	963	1.000	1.000	P51784.pdb.gz	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
5	AFDB:Q5D006	0.828	0.865	0.000	921	0.789	0.825	Q5D006.pdb.gz	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
6	AFDB:Q8R5H1	0.524	0.515	0.000	981	0.449	0.440	Q8R5H1.pdb.gz	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
7	AFDB:Q9R085	0.572	0.579	0.000	952	0.452	0.457	Q9R085.pdb.gz	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
8	AFDB:O22207	0.365	0.379	2.406E-79	924	0.325	0.339	O22207.pdb.gz	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
9	AFDB:O60079	0.489	0.482	8.707E-77	979	0.296	0.291	O60079.pdb.gz	UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp12 PE=1 SV=1
10	AFDB:Q9USM5	0.372	0.419	8.129E-71	849	0.255	0.290	Q9USM5.pdb.gz	UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp1 PE=3 SV=1
11	PDB:3mhsA	0.279	0.563	6.549E-20	455	0.099	0.209	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
12	PDB:5cvnB	0.267	0.752	1.104E-17	321	0.100	0.299	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:5k16B	0.250	0.687	2.475E-16	328	0.096	0.280	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:7yxxA	0.252	0.144	1.327E-14	1754	0.094	0.052	7yxxA.pdb.gz
15	PDB:4fjcE	0.244	0.515	1.743E-14	434	0.100	0.221	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
16	PDB:3ihpB	0.275	0.382	2.290E-14	681	0.114	0.162	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
17	PDB:7w3ax	0.270	0.503	2.030E-13	494	0.119	0.233	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
18	PDB:4wa6D	0.250	0.559	2.264E-13	415	0.085	0.198	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
19	PDB:7ay1D	0.274	0.724	6.741E-13	341	0.094	0.267	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
20	PDB:8a9kD	0.222	0.689	4.307E-12	285	0.088	0.298	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5E9A6	0.0	1920	920	0.955	1.000	G5E9A6_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=1
2	H7C189	0.0	569	621	0.321	0.498	H7C189_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=1
3	P35123	0.0	758	962	0.442	0.443	UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus OX=10090 GN=Usp4 PE=1 SV=3
4	P51784	0.0	2014	963	1.000	1.000	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
5	Q13107	0.0	745	963	0.435	0.435	UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=3
6	Q5D006	0.0	1542	921	0.771	0.806	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
7	Q8R5H1	0.0	781	981	0.440	0.432	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
8	Q9R085	0.0	798	952	0.447	0.452	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
9	Q9Y4E8	0.0	786	981	0.441	0.433	UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3
10	E7EZD6	5.71e-179	548	1009	0.296	0.282	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
11	O22207	1.12e-144	456	924	0.336	0.351	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
12	Q3UJD6	2.08e-118	395	1360	0.272	0.193	UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus OX=10090 GN=Usp19 PE=1 SV=1
13	O94966	2.01e-117	392	1318	0.266	0.194	UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19 PE=1 SV=2
14	K7EQL6	1.94e-83	296	1274	0.180	0.136	K7EQL6_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
15	Q8NFA0	7.97e-83	296	1604	0.180	0.108	UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
16	O60079	4.34e-82	288	979	0.218	0.215	UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp12 PE=1 SV=1
17	F1RCS0	2.23e-72	264	1436	0.136	0.091	F1RCS0_DANRE Ubiquitin carboxyl-terminal hydrolase 19 isoform X3 OS=Danio rerio OX=7955 GN=usp19 PE=1 SV=1
18	Q6J1Y9	2.04e-71	261	1357	0.153	0.108	UBP19_RAT Ubiquitin carboxyl-terminal hydrolase 19 OS=Rattus norvegicus OX=10116 GN=Usp19 PE=1 SV=1
19	Q9USM5	1.87e-70	253	849	0.188	0.213	UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp1 PE=3 SV=1
20	P35125	2.17e-69	255	1406	0.132	0.090	UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens OX=9606 GN=USP6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14205 Cys_rich_KTR	6e+02	11.7	Cysteine-rich KTR
2	PF06337 DUSP	7.6e-18	76.3	DUSP domain
3	PF14836 Ubiquitin_3	2.7e-08	45.0	Ubiquitin-like domain
4	PF00443 UCH	6.7e-90	312.9	Ubiquitin carboxyl-terminal hydrolase
5	PF13423 UCH_1	1.6e-06	39.6	Ubiquitin carboxyl-terminal hydrolase
6	PF14533 USP7_C2	0.00056	31.2	Ubiquitin-specific protease C-terminal
7	PF02891 zf-MIZ	1.1e+02	14.0	MIZ/SP-RING zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000218348

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343535	0.956	Ubiquitin carboxyl-terminal hydrolase 7
2	9606.ENSP00000369497	0.951	Breast cancer type 2 susceptibility protein
3	9606.ENSP00000361708	0.920	Transcription elongation factor A like family
4	9606.ENSP00000216797	0.906	NF-kappa-B inhibitor alpha
5	9606.ENSP00000328848	0.801	RNA-binding protein 10
6	9606.ENSP00000388806	0.779	Eukaryotic translation initiation factor 4B
7	9606.ENSP00000269305	0.769	Cellular tumor antigen p53
8	9606.ENSP00000324203	0.734	Telomerase Cajal body protein 1
9	9606.ENSP00000011619	0.724	Ran-binding protein 9
10	9606.ENSP00000434024	0.722	Histone H2AX
11	9606.ENSP00000338413	0.718	Ubiquitin-like modifier-activating enzyme 1
12	9606.ENSP00000285021	0.713	DNA repair protein complementing XP-C cells
13	9606.ENSP00000298746	0.692	Probable tRNA pseudouridine synthase 1
14	9606.ENSP00000229268	0.685	Ubiquitin carboxyl-terminal hydrolase 5
15	9606.ENSP00000426503	0.678	E3 ubiquitin-protein ligase RNF4
16	9606.ENSP00000350512	0.672	COP9 signalosome complex subunit 5
17	9606.ENSP00000003302	0.668	Ubiquitin carboxyl-terminal hydrolase 28
18	9606.ENSP00000481029	0.667	26S proteasome regulatory subunit 6A
19	9606.ENSP00000216455	0.666	Proteasome subunit alpha type-3
20	9606.ENSP00000404251	0.661	Transcription cofactor vestigial-like protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0004197	0.996	cysteine-type endopeptidase activity
GO:0008134	0.966	transcription factor binding
GO:0001221	0.828	transcription coregulator binding
GO:0001222	0.618	transcription corepressor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006508	0.996	proteolysis
GO:0036211	0.996	protein modification process
GO:0070647	0.989	protein modification by small protein conjugation or removal
GO:0016579	0.973	protein deubiquitination
GO:0009987	0.649	cellular process
GO:0065007	0.542	biological regulation
GO:0050789	0.519	regulation of biological process
GO:0050794	0.414	regulation of cellular process
GO:0019222	0.362	regulation of metabolic process
GO:0060255	0.333	regulation of macromolecule metabolic process
GO:0044237	0.325	cellular metabolic process
GO:0080090	0.316	regulation of primary metabolic process
GO:0051171	0.316	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.397	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.996	Cysteine endopeptidases.

[back to server]