StarFunc result for job id P51805

User Input

>input (1871 residues)
MPSVCLLLLLFLAVGGALGNRPFRAFVVTDTTLTHLAVHRVTGEVFVGAVNRVFKLAPNL
TELRAHVTGPVEDNARCYPPPSMRVCAHRLAPVDNINKLLLIDYAARRLVACGSIWQGIC
QFLRLDDLFKLGEPHHRKEHYLSGAQEPDSMAGVIVEQGQGPSKLFVGTAVDGKSEYFPT
LSSRKLISDEDSADMFSLVYQDEFVSSQIKIPSDTLSLYPAFDIYYIYGFVSASFVYFLT
LQLDTQQTLLDTAGEKFFTSKIVRMCAGDSEFYSYVEFPIGCSWRGVEYRLVQSAHLAKP
GLLLAQALGVPADEDVLFTIFSQGQKNRASPPRQTILCLFTLSNINAHIRRRIQSCYRGE
GTLALPWLLNKELPCINTPMQINGNFCGLVLNQPLGGLHVIEGLPLLADSTDGMASVAAY
TYRQHSVVFIGTRSGSLKKVRVDGFQDAHLYETVPVVDGSPILRDLLFSPDHRHIYLLSE
KQVSQLPVETCEQYQSCAACLGSGDPHCGWCVLRHRCCREGACLGASAPHGFAEELSKCV
QVRVRPNNVSVTSPGVQLTVTLHNVPDLSAGVSCAFEAAAENEAVLLPSGELLCPSPSLQ
ELRALTRGHGATRTVRLQLLSKETGVRFAGADFVFYNCSVLQSCMSCVGSPYPCHWCKYR
HTCTSRPHECSFQEGRVHSPEGCPEILPSGDLLIPVGVMQPLTLRAKNLPQPQSGQKNYE
CVVRVQGRQQRVPAVRFNSSSVQCQNASYSYEGDEHGDTELDFSVVWDGDFPIDKPPSFR
ALLYKCWAQRPSCGLCLKADPRFNCGWCISEHRCQLRTHCPAPKTNWMHLSQKGTRCSHP
RITQIHPLVGPKEGGTRVTIVGDNLGLLSREVGLRVAGVRCNSIPAEYISAERIVCEMEE
SLVPSPPPGPVELCVGDCSADFRTQSEQVYSFVTPTFDQVSPSRGPASGGTRLTISGSSL
DAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYT
QDPTVTRLEPTWSIINGSTAITVSGTHLLTVQEPRVRAKYRGIETTNTCQVINDTAMLCK
APGIFLGRPQPRAQGEHPDEFGFLLDHVQTARSLNRSSFTYYPDPSFEPLGPSGVLDVKP
GSHVVLKGKNLIPAAAGSSRLNYTVLIGGQPCSLTVSDTQLLCDSPSQTGRQPVMVLVGG
LEFWLGTLHISAERALTLPAMMGLAAGGGLLLLAITAVLVAYKRKTQDADRTLKRLQLQM
DNLESRVALECKEAFAELQTDINELTNHMDEVQIPFLDYRTYAVRVLFPGIEAHPVLKEL
DTPPNVEKALRLFGQLLHSRAFVLTFIHTLEAQSSFSMRDRGTVASLTMVALQSRLDYAT
GLLKQLLADLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLHKFLKECAGEPLFLLY
CAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVCPENEGSAQVPVKVLNC
DSITQAKDKLLDTVYKGIPYSQRPKAEDMDLEWRQGRMTRIILQDEDVTTKIECDWKRLN
SLAHYQVTDGSLVALVPKQVSAYNMANSFTFTRSLSRYESLLRTASSPDSLRSRAPMITP
DQETGTKLWHLVKNHDHADHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTA
HRGSALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHK
NSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDIAKMAS
ISDQDMDAYLVEQSRLHASDFSVLSALNELYFYVTKYRQEILTALDRDASCRKHKLRQKL
EQIISLVSSDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IRZ9	0.501	0.484	0.000	1945	0.294	0.283	A0A0R4IRZ9.pdb.gz
2	AFDB:A0A2R8QPJ6	0.661	0.653	0.000	1902	0.596	0.587	A0A2R8QPJ6.pdb.gz	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
3	AFDB:B0S5N4	0.644	0.637	0.000	1892	0.736	0.728	B0S5N4.pdb.gz	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	AFDB:B2RXS4	0.534	0.542	0.000	1842	0.326	0.331	B2RXS4.pdb.gz	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	AFDB:D3ZLH5	0.525	0.518	0.000	1902	0.331	0.325	D3ZLH5.pdb.gz	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
6	AFDB:F1Q7U0	0.453	0.390	0.000	2220	0.347	0.292	F1Q7U0.pdb.gz	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
7	AFDB:F1QBC0	0.535	0.537	0.000	1864	0.316	0.318	F1QBC0.pdb.gz	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
8	AFDB:O15031	0.536	0.545	0.000	1838	0.324	0.330	O15031.pdb.gz	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
9	AFDB:O43157	0.455	0.405	0.000	2135	0.356	0.312	O43157.pdb.gz	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
10	AFDB:O45657	0.374	0.390	0.000	1766	0.249	0.264	O45657.pdb.gz	PLX2_CAEEL Plexin-2 OS=Caenorhabditis elegans OX=6239 GN=plx-2 PE=1 SV=5
11	PDB:6vxkB	0.216	0.499	1.158E-26	747	0.082	0.205	6vxkB.pdb.gz
12	PDB:6qp7A	0.205	0.558	1.038E-20	620	0.051	0.153	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
13	PDB:3nvqA	0.194	0.547	4.483E-17	588	0.065	0.206	3nvqA.pdb.gz
14	PDB:3nvnA	0.151	0.618	8.010E-10	383	0.028	0.138	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
15	PDB:7sqcO0	0.064	0.088	1.348E-9	1140	0.054	0.089	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:5a42A	0.071	0.080	1.470E-9	1597	0.061	0.071	5a42A.pdb.gz
17	PDB:1e07A	0.061	0.132	3.500E-9	642	0.044	0.128	1e07A.pdb.gz
18	PDB:4lnvA	0.079	0.106	1.742E-8	1276	0.072	0.105	4lnvA.pdb.gz
19	PDB:7q5zA	0.075	0.095	1.077E-7	1344	0.043	0.060	7q5zA.pdb.gz
20	PDB:5nrlP	0.109	0.158	1.729E-6	1186	0.059	0.094	5nrlP.pdb.gz	Structure of a pre-catalytic spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QPJ6	2283	1902	0.599	0.589	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
2	A8IYK2	2532	1885	0.650	0.646	A8IYK2_DANRE Plexin-A1 OS=Danio rerio OX=7955 GN=plxna1 PE=1 SV=1
3	B0S5N4	2891	1892	0.740	0.732	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	B2RXS4	875	1842	0.328	0.333	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	C5H5I1	895	1864	0.330	0.332	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
6	D3ZLH5	890	1902	0.338	0.333	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
7	F1Q7U0	761	2220	0.253	0.213	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
8	F1QBC0	897	1864	0.329	0.330	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
9	H9XVP3	1314	1928	0.407	0.395	H9XVP3_DROME Plexin A, isoform F OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
10	O15031	905	1838	0.334	0.340	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
11	O43157	767	2135	0.253	0.222	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
12	O75051	2300	1894	0.597	0.590	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
13	O96681	1319	1945	0.409	0.393	O96681_DROME Plexin A OS=Drosophila melanogaster OX=7227 GN=PlexA PE=2 SV=1
14	P51805	3876	1871	0.999	0.999	PLXA3_HUMAN Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 SV=3
15	P70206	2557	1894	0.665	0.657	PLXA1_MOUSE Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1
16	P70207	2294	1894	0.598	0.591	PLXA2_MOUSE Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 SV=2
17	P70208	3665	1872	0.945	0.945	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2
18	Q0KIF1	1120	1505	0.337	0.419	Q0KIF1_DROME Plexin A, isoform B OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
19	Q3UH93	855	1925	0.336	0.327	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
20	Q3V5K0	1018	1945	0.355	0.342	Q3V5K0_CAEEL Sema domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=plx-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08337 Plexin_cytopl	1.2e-189	642.4	Plexin cytoplasmic RasGAP domain
2	PF20170 Plexin_RBD	1.2e-42	156.0	Plexin cytoplasmic RhoGTPase-binding domain
3	PF01437 PSI	3.4e-15	67.6	Plexin repeat
4	PF01403 Sema	9.7e-18	76.2	Sema domain
5	PF01833 TIG	4.5e-36	134.1	IPT/TIG domain
6	PF18020 TIG_2	7e-23	92.4	TIG domain found in plexin
7	PF17960 TIG_plexin	1.4e-15	68.2	TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358696

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353582	0.986	Neuropilin-2
2	9606.ENSP00000265362	0.980	Semaphorin-3A
3	9606.ENSP00000002829	0.971	Semaphorin-3F
4	9606.ENSP00000246792	0.951	Ras-related protein R-Ras
5	9606.ENSP00000265371	0.944	Neuropilin-1
6	9606.ENSP00000257414	0.943	Semaphorin-6A
7	9606.ENSP00000357909	0.927	Semaphorin-6C
8	9606.ENSP00000371936	0.922	Semaphorin-5A
9	9606.ENSP00000389588	0.922	Semaphorin-5B
10	9606.ENSP00000284136	0.921	Semaphorin-3D
11	9606.ENSP00000265361	0.914	Semaphorin-3C
12	9606.ENSP00000336740	0.913	LIM domain kinase 1
13	9606.ENSP00000324806	0.905	Glycogen synthase kinase-3 beta
14	9606.ENSP00000356000	0.904	Plexin-A2
15	9606.ENSP00000377061	0.904	Plexin-A1
16	9606.ENSP00000352882	0.902	Plexin-A4
17	9606.ENSP00000304283	0.901	Ras-related C3 botulinum toxin substrate 3
18	9606.ENSP00000249071	0.897	Ras-related C3 botulinum toxin substrate 2
19	9606.ENSP00000484146	0.891	Semaphorin-3B
20	9606.ENSP00000467290	0.889	Semaphorin-6B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	0.995	transmembrane signaling receptor activity
GO:0017154	0.993	semaphorin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0048856	0.986	anatomical structure development
GO:0050896	0.985	response to stimulus
GO:0009653	0.984	anatomical structure morphogenesis
GO:0050794	0.983	regulation of cellular process
GO:0007275	0.981	multicellular organism development
GO:0071840	0.975	cellular component organization or biogenesis
GO:0016043	0.974	cellular component organization
GO:0048731	0.971	system development
GO:0007154	0.957	cell communication
GO:0023052	0.956	signaling
GO:0040012	0.954	regulation of locomotion
GO:0071526	0.950	semaphorin-plexin signaling pathway
GO:0048812	0.945	neuron projection morphogenesis
GO:0061564	0.942	axon development
GO:0000904	0.910	cell morphogenesis involved in differentiation
GO:0048667	0.898	cell morphogenesis involved in neuron differentiation
GO:0051128	0.871	regulation of cellular component organization
GO:0007409	0.860	axonogenesis
GO:0097485	0.857	neuron projection guidance
GO:0007411	0.838	axon guidance
GO:0010975	0.833	regulation of neuron projection development
GO:0048513	0.826	animal organ development
GO:0022603	0.763	regulation of anatomical structure morphogenesis
GO:0048519	0.760	negative regulation of biological process
GO:0051239	0.746	regulation of multicellular organismal process
GO:0048518	0.740	positive regulation of biological process
GO:0050770	0.734	regulation of axonogenesis
GO:0008361	0.716	regulation of cell size
GO:0016477	0.697	cell migration
GO:0061387	0.659	regulation of extent of cell growth
GO:0030900	0.643	forebrain development
GO:0048523	0.608	negative regulation of cellular process
GO:0048522	0.577	positive regulation of cellular process
GO:0048583	0.541	regulation of response to stimulus
GO:1990138	0.540	neuron projection extension
GO:0050919	0.513	negative chemotaxis
GO:0021953	0.512	central nervous system neuron differentiation
GO:0021761	0.482	limbic system development
GO:0030516	0.405	regulation of axon extension
GO:0048646	0.398	anatomical structure formation involved in morphogenesis
GO:0021872	0.379	forebrain generation of neurons

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.939	protein-containing complex
GO:0043235	0.695	receptor complex
GO:0043227	0.540	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]