StarFunc result for job id P51809

User Input

>input (220 residues)
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRI
VYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSEN
KGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLAR
AMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R061	0.839	0.839	3.880E-42	220	1.000	1.000	A0A024R061.pdb.gz
2	AFDB:Q7JYX5	0.872	0.880	3.502E-25	218	0.518	0.523	Q7JYX5.pdb.gz	Q7JYX5_DROME RH15778p OS=Drosophila melanogaster OX=7227 GN=Vamp7 PE=1 SV=1
3	AFDB:Q9FMR5	0.778	0.774	1.047E-22	221	0.400	0.398	Q9FMR5.pdb.gz	VA714_ARATH Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana OX=3702 GN=VAMP714 PE=1 SV=1
4	AFDB:Q9LFP1	0.704	0.701	1.142E-21	221	0.382	0.380	Q9LFP1.pdb.gz	VA713_ARATH Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana OX=3702 GN=VAMP713 PE=1 SV=1
5	AFDB:Q86AQ7	0.725	0.618	1.215E-21	260	0.377	0.319	Q86AQ7.pdb.gz	VAM7B_DICDI Vesicle-associated membrane protein 7B OS=Dictyostelium discoideum OX=44689 GN=vamp7B PE=3 SV=1
6	AFDB:O49377	0.707	0.711	1.755E-21	219	0.395	0.397	O49377.pdb.gz	VA711_ARATH Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana OX=3702 GN=VAMP711 PE=1 SV=2
7	AFDB:Q9SIQ9	0.701	0.704	4.138E-21	219	0.395	0.397	Q9SIQ9.pdb.gz	VA712_ARATH Vesicle-associated membrane protein 712 OS=Arabidopsis thaliana OX=3702 GN=VAMP712 PE=2 SV=1
8	AFDB:O48850	0.654	0.513	3.727E-18	285	0.355	0.274	O48850.pdb.gz	VA725_ARATH Vesicle-associated membrane protein 725 OS=Arabidopsis thaliana OX=3702 GN=VAMP725 PE=2 SV=2
9	AFDB:B9DH97	0.683	0.659	5.877E-17	229	0.364	0.349	B9DH97.pdb.gz	B9DH97_ARATH AT2G33120 protein OS=Arabidopsis thaliana OX=3702 GN=SAR1 PE=1 SV=1
10	AFDB:Q9M376	0.614	0.567	4.442E-16	240	0.327	0.300	Q9M376.pdb.gz	VA727_ARATH Vesicle-associated membrane protein 727 OS=Arabidopsis thaliana OX=3702 GN=VAMP727 PE=1 SV=1
11	PDB:2nupC	0.455	0.714	3.846E-8	137	0.145	0.234	2nupC.pdb.gz	The Transport Signal on Sec22 for Packaging into COPII-Coated Vesicles is a Conformational Epitope
12	PDB:6j7fC	0.525	0.585	2.122E-5	195	0.123	0.138	6j7fC.pdb.gz	Complex of GGTaseIII, farnesyl-Ykt6 (C-terminal methylated), and GGPP
13	PDB:2jkrS	0.382	0.545	5.808E-4	142	0.050	0.077	2jkrS.pdb.gz	A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
14	PDB:1w63Q	0.411	0.571	8.389E-4	148	0.082	0.122	1w63Q.pdb.gz
15	PDB:2jkrM	0.407	0.234	1.008E-3	409	0.082	0.044	2jkrM.pdb.gz	A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
16	PDB:7rwaM	0.379	0.234	1.370E-3	379	0.068	0.040	7rwaM.pdb.gz	Structural basis of an endocytic checkpoint that primes the AP2 clathrin adaptor for cargo internalization.
17	PDB:4hmyS	0.403	0.572	2.237E-3	145	0.064	0.097	4hmyS.pdb.gz	Structural Basis for Recruitment and Activation of the AP-1 Clathrin Adaptor Complex by Arf1.
18	PDB:7b6dC	0.277	0.389	2.858E-3	145	0.109	0.166	7b6dC.pdb.gz
19	PDB:7t3aC	0.288	0.175	2.858E-3	406	0.100	0.054	7t3aC.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.
20	PDB:2j3tC	0.312	0.464	3.231E-3	141	0.064	0.099	2j3tC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51809	1.37e-166	459	220	1.000	1.000	VAMP7_HUMAN Vesicle-associated membrane protein 7 OS=Homo sapiens OX=9606 GN=VAMP7 PE=1 SV=3
2	B2R6P4	2.16e-165	456	220	0.995	0.995	B2R6P4_HUMAN cDNA, FLJ93048, highly similar to Homo sapiens synaptobrevin-like 1 (SYBL1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
3	P70280	3.05e-162	448	220	0.973	0.973	VAMP7_MOUSE Vesicle-associated membrane protein 7 OS=Mus musculus OX=10090 GN=Vamp7 PE=1 SV=1
4	Q9JHW5	7.55e-149	414	220	0.950	0.950	VAMP7_RAT Vesicle-associated membrane protein 7 OS=Rattus norvegicus OX=10116 GN=Vamp7 PE=1 SV=1
5	B4DIH9	9.91e-127	357	181	0.777	0.945	B4DIH9_HUMAN cDNA FLJ53045, highly similar to Synaptobrevin-like protein 1 OS=Homo sapiens OX=9606 PE=2 SV=1
6	Q7JYX5	1.22e-86	257	218	0.518	0.523	Q7JYX5_DROME RH15778p OS=Drosophila melanogaster OX=7227 GN=Vamp7 PE=1 SV=1
7	Q9FMR5	1.26e-59	188	221	0.414	0.412	VA714_ARATH Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana OX=3702 GN=VAMP714 PE=1 SV=1
8	Q9LFP1	1.27e-53	173	221	0.382	0.380	VA713_ARATH Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana OX=3702 GN=VAMP713 PE=1 SV=1
9	Q86AQ7	2.84e-51	168	260	0.373	0.315	VAM7B_DICDI Vesicle-associated membrane protein 7B OS=Dictyostelium discoideum OX=44689 GN=vamp7B PE=3 SV=1
10	O49377	8.08e-51	166	219	0.400	0.402	VA711_ARATH Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana OX=3702 GN=VAMP711 PE=1 SV=2
11	Q9SIQ9	1.63e-47	157	219	0.395	0.397	VA712_ARATH Vesicle-associated membrane protein 712 OS=Arabidopsis thaliana OX=3702 GN=VAMP712 PE=2 SV=1
12	Q9ZTW3	1.03e-39	137	219	0.359	0.361	VA721_ARATH Vesicle-associated membrane protein 721 OS=Arabidopsis thaliana OX=3702 GN=VAMP721 PE=2 SV=1
13	Q9MAS5	1.35e-39	137	220	0.350	0.350	VA726_ARATH Putative vesicle-associated membrane protein 726 OS=Arabidopsis thaliana OX=3702 GN=VAMP726 PE=2 SV=2
14	O48850	9.16e-38	134	285	0.350	0.270	VA725_ARATH Vesicle-associated membrane protein 725 OS=Arabidopsis thaliana OX=3702 GN=VAMP725 PE=2 SV=2
15	Q9M376	1.02e-37	133	240	0.341	0.312	VA727_ARATH Vesicle-associated membrane protein 727 OS=Arabidopsis thaliana OX=3702 GN=VAMP727 PE=1 SV=1
16	B9DH97	6.37e-36	128	229	0.359	0.345	B9DH97_ARATH AT2G33120 protein OS=Arabidopsis thaliana OX=3702 GN=SAR1 PE=1 SV=1
17	Q54NW7	1.45e-30	114	216	0.305	0.310	VAM7A_DICDI Vesicle-associated membrane protein 7A OS=Dictyostelium discoideum OX=44689 GN=vamp7A PE=1 SV=1
18	Q2UHD9	7.19e-25	100	254	0.332	0.287	Q2UHD9_ASPOR Synaptobrevin homolog YKT6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000485 PE=3 SV=1
19	G0S5G3	3.05e-23	95.5	242	0.282	0.256	G0S5G3_CHATD Synaptobrevin homolog YKT6 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0032860 PE=1 SV=1
20	Q8VY69	5.06e-20	86.7	217	0.282	0.286	VA723_ARATH Vesicle-associated membrane protein 723 OS=Arabidopsis thaliana OX=3702 GN=VAMP723 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13774 Longin	1.4e-23	94.0	Regulated-SNARE-like domain
2	PF16192 PMT_4TMC	2.2e+02	12.8	C-terminal four TMM region of protein-O-mannosyltransferase
3	PF00957 Synaptobrevin	2.5e-27	105.8	Synaptobrevin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000017686

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000119	0.995	Synaptosomal-associated protein, 29kDa
2	61853.ENSNLEP00000010811	0.993	Uncharacterized protein
3	61853.ENSNLEP00000017581	0.992	Synaptosomal-associated protein, 25kDa
4	61853.ENSNLEP00000020725	0.991	Syntaxin 17
5	61853.ENSNLEP00000017727	0.989	Syntaxin 7
6	61853.ENSNLEP00000011769	0.983	Syntaxin 12
7	61853.ENSNLEP00000019525	0.982	Syntaxin 4
8	61853.ENSNLEP00000005416	0.980	Synaptosomal-associated protein, 23kDa
9	61853.ENSNLEP00000005123	0.976	Syntaxin 5
10	61853.ENSNLEP00000012262	0.968	Syntaxin 8
11	61853.ENSNLEP00000019437	0.967	Syntaxin 6
12	61853.ENSNLEP00000003766	0.966	N-ethylmaleimide-sensitive factor attachment protein, alpha
13	61853.ENSNLEP00000019222	0.966	Vesicle transport through interaction with t-SNAREs 1A
14	61853.ENSNLEP00000000944	0.963	Uncharacterized protein
15	61853.ENSNLEP00000022210	0.963	Uncharacterized protein
16	61853.ENSNLEP00000019507	0.956	Syntaxin 1B
17	61853.ENSNLEP00000005973	0.951	Uncharacterized protein
18	61853.ENSNLEP00000011409	0.949	Syntaxin 16
19	61853.ENSNLEP00000018740	0.941	Bet1 golgi vesicular membrane trafficking protein
20	61853.ENSNLEP00000015920	0.937	Syntaxin 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000149	0.526	SNARE binding
GO:0005484	0.464	SNAP receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016192	0.996	vesicle-mediated transport
GO:0061025	0.996	membrane fusion
GO:0048284	0.996	organelle fusion
GO:0090174	0.992	organelle membrane fusion
GO:0016050	0.986	vesicle organization
GO:0006906	0.984	vesicle fusion
GO:0051641	0.974	cellular localization
GO:0051649	0.953	establishment of localization in cell
GO:0033036	0.828	macromolecule localization
GO:0046907	0.827	intracellular transport
GO:0071702	0.778	organic substance transport
GO:0065007	0.750	biological regulation
GO:0071705	0.588	nitrogen compound transport
GO:0045184	0.583	establishment of protein localization
GO:0050789	0.580	regulation of biological process
GO:0050896	0.568	response to stimulus
GO:0015031	0.547	protein transport
GO:0032940	0.426	secretion by cell
GO:0050794	0.415	regulation of cellular process
GO:0032501	0.397	multicellular organismal process
GO:0048193	0.355	Golgi vesicle transport
GO:0006887	0.330	exocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0098588	0.998	bounding membrane of organelle
GO:0032991	0.984	protein-containing complex
GO:0005773	0.976	vacuole
GO:0031982	0.971	vesicle
GO:0005886	0.934	plasma membrane
GO:0031984	0.931	organelle subcompartment
GO:0000323	0.928	lytic vacuole
GO:0005774	0.895	vacuolar membrane
GO:0005764	0.857	lysosome
GO:0031410	0.828	cytoplasmic vesicle
GO:0005765	0.790	lysosomal membrane
GO:0042175	0.718	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005783	0.718	endoplasmic reticulum
GO:0098827	0.683	endoplasmic reticulum subcompartment
GO:0005789	0.650	endoplasmic reticulum membrane
GO:0098796	0.606	membrane protein complex
GO:0031201	0.444	SNARE complex
GO:0005576	0.422	extracellular region
GO:0042995	0.397	cell projection
GO:0005794	0.387	Golgi apparatus
GO:0030659	0.366	cytoplasmic vesicle membrane
GO:0120025	0.353	plasma membrane bounded cell projection
GO:0099503	0.344	secretory vesicle
GO:0030139	0.322	endocytic vesicle
GO:0043228	0.300	non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]