StarFunc result for job id P51812

User Input

>input (740 residues)
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGH
EKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERD
ILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALA
LDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVV
NRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR
MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPE
FTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLK
DVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDL
KPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD
IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKML
HVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEP
VGRSTLAQRRGIKKITSTAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4ID09	0.928	0.936	0.000	733	0.853	0.861	A0A0R4ID09.pdb.gz	A0A0R4ID09_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=id:ibd1103 PE=1 SV=1
2	AFDB:A0A384MDW3	0.927	0.927	0.000	740	1.000	1.000	A0A384MDW3.pdb.gz	A0A384MDW3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 PE=2 SV=1
3	AFDB:Q15349	0.915	0.924	0.000	733	0.795	0.802	Q15349.pdb.gz	KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens OX=9606 GN=RPS6KA2 PE=1 SV=2
4	AFDB:Q15418	0.927	0.933	0.000	735	0.803	0.808	Q15418.pdb.gz	KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2
5	AFDB:Q9UK32	0.878	0.873	2.552E-102	745	0.774	0.769	Q9UK32.pdb.gz	KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens OX=9606 GN=RPS6KA6 PE=1 SV=1
6	AFDB:A2RUY2	0.463	0.475	7.405E-102	720	0.814	0.836	A2RUY2.pdb.gz
7	AFDB:E7F469	0.831	0.851	3.565E-100	722	0.818	0.838	E7F469.pdb.gz
8	AFDB:A0A2R8Q8Y4	0.464	0.501	1.347E-98	685	0.796	0.860	A0A2R8Q8Y4.pdb.gz
9	AFDB:Q7TPS0	0.844	0.819	5.731E-96	764	0.758	0.734	Q7TPS0.pdb.gz	KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus OX=10090 GN=Rps6ka6 PE=1 SV=2
10	AFDB:Q9VR61	0.766	0.631	1.436E-84	911	0.576	0.468	Q9VR61.pdb.gz	Q9VR61_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=S6kII PE=3 SV=1
11	PDB:3pfqA	0.408	0.572	3.237E-27	523	0.186	0.264	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6byrA	0.399	0.716	1.453E-26	405	0.159	0.291	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:4mk0A	0.394	0.460	3.826E-26	631	0.161	0.189	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
14	PDB:3pvuA	0.381	0.461	9.602E-26	609	0.162	0.197	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
15	PDB:4yhjA	0.400	0.582	9.814E-25	501	0.153	0.226	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
16	PDB:6pjxA	0.401	0.538	5.345E-24	543	0.149	0.203	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
17	PDB:5x3fB	0.364	0.757	6.181E-24	349	0.146	0.309	5x3fB.pdb.gz
18	PDB:6s9wA	0.347	0.604	1.976E-23	411	0.181	0.326	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
19	PDB:3nynA	0.398	0.527	3.207E-23	554	0.155	0.208	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
20	PDB:6hhgA	0.337	0.627	8.447E-23	386	0.177	0.339	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4ID09	1310	733	0.855	0.864	A0A0R4ID09_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=id:ibd1103 PE=1 SV=1
2	A0A384MDW3	1543	740	1.000	1.000	A0A384MDW3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 PE=2 SV=1
3	B4DG22	1475	711	0.961	1.000	B4DG22_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
4	B7ZB17	1482	712	0.962	1.000	B7ZB17_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
5	E9PGT3	1195	724	0.796	0.814	E9PGT3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=1
6	F1R2A7	1256	709	0.820	0.856	F1R2A7_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=zgc:158386 PE=1 SV=1
7	O75582	566	802	0.423	0.390	KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5 PE=1 SV=1
8	P18653	1204	724	0.800	0.818	KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus OX=10090 GN=Rps6ka1 PE=1 SV=1
9	P18654	1538	740	0.999	0.999	KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus OX=10090 GN=Rps6ka3 PE=1 SV=2
10	P51812	1543	740	1.000	1.000	KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
11	Q15349	1231	733	0.796	0.804	KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens OX=9606 GN=RPS6KA2 PE=1 SV=2
12	Q15418	1226	735	0.809	0.815	KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2
13	Q24496	851	910	0.586	0.477	Q24496_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=S6kII PE=1 SV=1
14	Q63531	1224	735	0.808	0.814	KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus OX=10116 GN=Rps6ka1 PE=1 SV=1
15	Q7TPS0	1153	764	0.753	0.729	KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus OX=10090 GN=Rps6ka6 PE=1 SV=2
16	Q7ZVH8	1302	732	0.853	0.862	Q7ZVH8_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=rps6ka3 PE=1 SV=1
17	Q86NP0	841	892	0.578	0.480	Q86NP0_DROME SD05277p OS=Drosophila melanogaster OX=7227 GN=S6kII PE=2 SV=1
18	Q9PTN1	1404	737	0.920	0.924	Q9PTN1_XENLA Ribosomal protein S6 kinase OS=Xenopus laevis OX=8355 GN=rps6ka3.L PE=1 SV=1
19	Q9UK32	1189	745	0.776	0.770	KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens OX=9606 GN=RPS6KA6 PE=1 SV=1
20	Q9VR61	851	911	0.586	0.476	Q9VR61_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=S6kII PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.4e-06	39.2	ABC1 atypical kinase-like domain
2	PF01636 APH	0.041	25.3	Phosphotransferase enzyme family
3	PF13095 FTA2	7.6	17.7	Kinetochore Sim4 complex subunit FTA2
4	PF12330 Haspin_kinase	0.45	21.0	Haspin like kinase domain
5	PF06293 Kdo	1.9e-07	42.2	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	8.9e-10	49.9	Kinase-like
7	PF00069 Pkinase	2e-143	488.1	Protein kinase domain
8	PF00433 Pkinase_C	0.0025	29.8	Protein kinase C terminal domain
9	PF17667 Pkinase_fungal	4e-06	37.5	Fungal protein kinase
10	PF07714 PK_Tyr_Ser-Thr	1.9e-75	265.1	Protein tyrosine and serine/threonine kinase
11	PF01163 RIO1	1.7e+02	13.2	RIO1 family
12	PF19974 TCAD9	99	13.4	Ternary complex associated domain 9
13	PF01921 tRNA-synt_1f	3.5e+02	11.5	tRNA synthetases class I (K)
14	PF10707 YrbL-PhoP_reg	6.1	18.0	PhoP regulatory network protein YrbL

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000010673

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000009828	0.987	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
2	60711.ENSCSAP00000002490	0.983	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
3	60711.ENSCSAP00000007256	0.956	Tuberous sclerosis 2
4	60711.ENSCSAP00000004148	0.950	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
5	60711.ENSCSAP00000011107	0.930	Tuberous sclerosis 1
6	60711.ENSCSAP00000002623	0.858	Activating transcription factor 4
7	60711.ENSCSAP00000006347	0.852	cAMP responsive element binding protein 1
8	60711.ENSCSAP00000012944	0.837	BUB1 mitotic checkpoint serine/threonine kinase
9	60711.ENSCSAP00000014294	0.817	3-phosphoinositide dependent protein kinase 1
10	60711.ENSCSAP00000006323	0.813	MEFV, pyrin innate immunity regulator
11	60711.ENSCSAP00000006516	0.811	Protein kinase, membrane associated tyrosine/threonine 1
12	60711.ENSCSAP00000005654	0.793	Ribosomal protein S6
13	60711.ENSCSAP00000018747	0.785	Belongs to the eukaryotic ribosomal protein eS6 family.
14	60711.ENSCSAP00000007252	0.765	HRas proto-oncogene, GTPase
15	60711.ENSCSAP00000007820	0.755	Serum response factor (c-fos serum response element-binding transcription factor)
16	60711.ENSCSAP00000017031	0.754	Ribosomal protein S6 kinase, 90kDa, polypeptide 1
17	60711.ENSCSAP00000008353	0.750	Ribosomal protein S6 kinase, 90kDa, polypeptide 2
18	60711.ENSCSAP00000004025	0.749	KRAS proto-oncogene, GTPase
19	60711.ENSCSAP00000016369	0.705	NRAS proto-oncogene, GTPase
20	60711.ENSCSAP00000011235	0.701	TIA1 cytotoxic granule-associated RNA binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0043167	0.357	ion binding
GO:0097159	0.331	organic cyclic compound binding
GO:1901363	0.330	heterocyclic compound binding
GO:0019899	0.327	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0050896	0.895	response to stimulus
GO:0007154	0.746	cell communication
GO:0019222	0.740	regulation of metabolic process
GO:0048518	0.736	positive regulation of biological process
GO:0023052	0.733	signaling
GO:0051716	0.687	cellular response to stimulus
GO:0060255	0.620	regulation of macromolecule metabolic process
GO:0007165	0.619	signal transduction
GO:0032501	0.569	multicellular organismal process
GO:0080090	0.539	regulation of primary metabolic process
GO:0051171	0.520	regulation of nitrogen compound metabolic process
GO:0031323	0.513	regulation of cellular metabolic process
GO:0008152	0.505	metabolic process
GO:0048519	0.503	negative regulation of biological process
GO:0048522	0.496	positive regulation of cellular process
GO:0071704	0.492	organic substance metabolic process
GO:0044238	0.452	primary metabolic process
GO:0044237	0.425	cellular metabolic process
GO:0006807	0.422	nitrogen compound metabolic process
GO:0043170	0.407	macromolecule metabolic process
GO:0048523	0.393	negative regulation of cellular process
GO:0010468	0.382	regulation of gene expression
GO:0009893	0.357	positive regulation of metabolic process
GO:0010604	0.352	positive regulation of macromolecule metabolic process
GO:0009889	0.341	regulation of biosynthetic process
GO:0010556	0.332	regulation of macromolecule biosynthetic process
GO:0031326	0.306	regulation of cellular biosynthetic process
GO:0031325	0.305	positive regulation of cellular metabolic process
GO:0048583	0.304	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0031981	0.999	nuclear lumen
GO:0005654	0.992	nucleoplasm
GO:0043228	0.966	non-membrane-bounded organelle
GO:0043232	0.964	intracellular non-membrane-bounded organelle
GO:0005730	0.754	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]