StarFunc result for job id P51813

User Input

>input (675 residues)
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVL
KMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDF
PDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFPESSSSEEEENLDDYDWFAGN
ISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLY
LAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL
KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCS
KEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAAR
NCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGI
LMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQ
QLLSSIEPLREKDKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51813	1.000	1.000	0.000	675	1.000	1.000	P51813.pdb.gz	BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens OX=9606 GN=BMX PE=1 SV=1
2	AFDB:F8W3B7	0.433	0.456	2.394E-69	640	0.444	0.469	F8W3B7.pdb.gz	F8W3B7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=btk PE=3 SV=1
3	AFDB:A0A0G2KA94	0.433	0.434	7.337E-68	674	0.455	0.455	A0A0G2KA94.pdb.gz	A0A0G2KA94_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
4	AFDB:P08630	0.430	0.373	4.198E-60	786	0.401	0.345	P08630.pdb.gz	BTKL_DROME Tyrosine-protein kinase Btk OS=Drosophila melanogaster OX=7227 GN=Btk PE=2 SV=2
5	AFDB:P42682	0.399	0.510	3.473E-50	527	0.332	0.425	P42682.pdb.gz	TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus OX=10090 GN=Txk PE=1 SV=1
6	AFDB:P42681	0.384	0.488	7.257E-46	527	0.339	0.435	P42681.pdb.gz	TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens OX=9606 GN=TXK PE=1 SV=3
7	AFDB:Q9V9J3	0.392	0.509	1.867E-39	517	0.228	0.298	Q9V9J3.pdb.gz	SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster OX=7227 GN=Src42A PE=1 SV=1
8	AFDB:Q5ZMB9	0.391	0.531	1.091E-38	492	0.215	0.295	Q5ZMB9.pdb.gz	Q5ZMB9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=LYN PE=1 SV=1
9	AFDB:Q9H3Y6	0.383	0.527	1.214E-38	488	0.212	0.293	Q9H3Y6.pdb.gz	SRMS_HUMAN Tyrosine-protein kinase Srms OS=Homo sapiens OX=9606 GN=SRMS PE=1 SV=1
10	AFDB:O45539	0.408	0.537	3.178E-38	507	0.221	0.294	O45539.pdb.gz	SRC2_CAEEL Tyrosine protein-kinase src-2 OS=Caenorhabditis elegans OX=6239 GN=src-2 PE=1 SV=2
11	PDB:2h8hA	0.390	0.586	2.236E-37	445	0.222	0.337	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.362	0.548	8.800E-30	441	0.221	0.338	1k9aB.pdb.gz
13	PDB:4fl2A	0.382	0.462	1.213E-29	555	0.193	0.234	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.370	0.450	3.002E-28	551	0.179	0.220	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:6s73A	0.342	0.819	1.046E-15	269	0.092	0.230	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:8dksA	0.308	0.691	1.296E-15	283	0.104	0.247	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:5ufuA	0.333	0.590	1.987E-15	369	0.098	0.179	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:7mfdA	0.328	0.523	3.216E-15	410	0.126	0.207	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
19	PDB:4zhxA	0.328	0.527	5.204E-15	409	0.095	0.156	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:4rerA	0.320	0.463	5.490E-15	459	0.098	0.144	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K134	0.0	595	637	0.467	0.495	A0A0G2K134_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
2	A0A0G2K6M9	0.0	656	661	0.496	0.507	A0A0G2K6M9_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
3	A0A0G2KA94	0.0	605	674	0.462	0.463	A0A0G2KA94_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
4	A0A8I5ZXG2	0.0	556	607	0.434	0.483	A0A8I5ZXG2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
5	A0A8I6A3K6	0.0	585	681	0.447	0.443	A0A8I6A3K6_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
6	B2RYC7	0.0	605	629	0.462	0.496	B2RYC7_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
7	P24604	0.0	595	630	0.456	0.489	TEC_MOUSE Tyrosine-protein kinase Tec OS=Mus musculus OX=10090 GN=Tec PE=1 SV=2
8	P35991	0.0	657	659	0.496	0.508	BTK_MOUSE Tyrosine-protein kinase BTK OS=Mus musculus OX=10090 GN=Btk PE=1 SV=4
9	P42680	0.0	610	631	0.465	0.498	TEC_HUMAN Tyrosine-protein kinase Tec OS=Homo sapiens OX=9606 GN=TEC PE=1 SV=2
10	P51813	0.0	1411	675	1.000	1.000	BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens OX=9606 GN=BMX PE=1 SV=1
11	Q03526	0.0	562	625	0.443	0.478	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
12	Q06187	0.0	653	659	0.496	0.508	BTK_HUMAN Tyrosine-protein kinase BTK OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=3
13	Q08881	0.0	573	620	0.450	0.490	ITK_HUMAN Tyrosine-protein kinase ITK/TSK OS=Homo sapiens OX=9606 GN=ITK PE=1 SV=1
14	Q5S255	0.0	656	660	0.496	0.508	Q5S255_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=2 SV=1
15	Q8JH64	0.0	643	657	0.492	0.505	BTK_CHICK Tyrosine-protein kinase BTK OS=Gallus gallus OX=9031 GN=BTK PE=1 SV=1
16	U3NG26	0.0	534	568	0.419	0.498	U3NG26_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=1
17	F8W3B7	1.51e-164	488	640	0.317	0.334	F8W3B7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=btk PE=3 SV=1
18	P42681	9.08e-163	480	527	0.354	0.454	TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens OX=9606 GN=TXK PE=1 SV=3
19	P42682	1.25e-160	474	527	0.313	0.400	TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus OX=10090 GN=Txk PE=1 SV=1
20	A0A8I6GBZ8	1.85e-143	433	602	0.290	0.326	A0A8I6GBZ8_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	87	13.7	ABC1 atypical kinase-like domain
2	PF00779 BTK	2.1e-09	48.3	BTK motif
3	PF14531 Kinase-like	95	13.8	Kinase-like
4	PF00169 PH	4e-15	67.6	PH domain
5	PF00069 Pkinase	1.5e-43	160.6	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	7.9e-92	318.8	Protein tyrosine and serine/threonine kinase
7	PF00017 SH2	4.6e-18	76.4	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350224

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325594	0.949	RUN and FYVE domain-containing protein 1
2	9606.ENSP00000264657	0.943	Signal transducer and activator of transcription 3
3	9606.ENSP00000341189	0.943	Focal adhesion kinase 1
4	9606.ENSP00000311032	0.937	Caspase-3
5	9606.ENSP00000362680	0.932	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000337825	0.927	Tyrosine-protein kinase Lck
7	9606.ENSP00000369375	0.920	Angiopoietin-1 receptor
8	9606.ENSP00000346671	0.907	Tyrosine-protein kinase Fyn
9	9606.ENSP00000462468	0.906	Tyrosine-protein kinase Yes
10	9606.ENSP00000428340	0.902	Angiopoietin-1
11	9606.ENSP00000452414	0.834	Protein tyrosine phosphatase, non-receptor type 21
12	9606.ENSP00000339191	0.772	Caveolin-1
13	9606.ENSP00000365435	0.753	Tumor necrosis factor receptor superfamily member 1B
14	9606.ENSP00000265404	0.740	Signal-transducing adaptor protein 1
15	9606.ENSP00000269305	0.722	Cellular tumor antigen p53
16	9606.ENSP00000401399	0.720	Myeloid differentiation primary response protein MyD88
17	9606.ENSP00000373301	0.613	SH3 domain-binding protein 5
18	9606.ENSP00000391669	0.596	Breast cancer anti-estrogen resistance protein 1
19	9606.ENSP00000354972	0.575	N-alpha-acetyltransferase 35, NatC auxiliary subunit
20	9606.ENSP00000234313	0.574	Pleckstrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004715	1.000	non-membrane spanning protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0071704	0.992	organic substance metabolic process
GO:0007154	0.992	cell communication
GO:0023052	0.990	signaling
GO:0050794	0.990	regulation of cellular process
GO:0044238	0.982	primary metabolic process
GO:0051716	0.979	cellular response to stimulus
GO:0044237	0.974	cellular metabolic process
GO:0006807	0.958	nitrogen compound metabolic process
GO:0043170	0.947	macromolecule metabolic process
GO:1901564	0.947	organonitrogen compound metabolic process
GO:0032502	0.940	developmental process
GO:0006793	0.935	phosphorus metabolic process
GO:0007165	0.927	signal transduction
GO:0016310	0.926	phosphorylation
GO:0043412	0.912	macromolecule modification
GO:0048518	0.894	positive regulation of biological process
GO:0006468	0.889	protein phosphorylation
GO:0048856	0.865	anatomical structure development
GO:0019222	0.802	regulation of metabolic process
GO:0048522	0.729	positive regulation of cellular process
GO:0046777	0.713	protein autophosphorylation
GO:0060255	0.644	regulation of macromolecule metabolic process
GO:0048583	0.635	regulation of response to stimulus
GO:0032501	0.631	multicellular organismal process
GO:0048519	0.622	negative regulation of biological process
GO:0007166	0.529	cell surface receptor signaling pathway
GO:0009893	0.498	positive regulation of metabolic process
GO:0010604	0.484	positive regulation of macromolecule metabolic process
GO:0080090	0.467	regulation of primary metabolic process
GO:0048584	0.443	positive regulation of response to stimulus
GO:0051171	0.426	regulation of nitrogen compound metabolic process
GO:0031323	0.419	regulation of cellular metabolic process
GO:0051239	0.411	regulation of multicellular organismal process
GO:0051179	0.381	localization
GO:0002682	0.381	regulation of immune system process
GO:0048523	0.377	negative regulation of cellular process
GO:0002376	0.375	immune system process
GO:0010468	0.362	regulation of gene expression
GO:0007169	0.357	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0051234	0.343	establishment of localization
GO:0023051	0.325	regulation of signaling
GO:0031325	0.316	positive regulation of cellular metabolic process
GO:0042221	0.315	response to chemical
GO:0009966	0.315	regulation of signal transduction
GO:0006810	0.310	transport
GO:0050776	0.305	regulation of immune response
GO:0051173	0.301	positive regulation of nitrogen compound metabolic process
GO:0018108	0.301	peptidyl-tyrosine phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.998	plasma membrane
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0005634	0.951	nucleus
GO:0031981	0.415	nuclear lumen
GO:0005654	0.338	nucleoplasm
GO:0098590	0.306	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.2	1.000	non-specific protein-tyrosine kinase.

[back to server]