StarFunc result for job id P51815

User Input

>input (510 residues)
MAMRELNADSCSSPQMGAMWETSGSVKENSSQSKKYSTKIENLGPESACRHFWSFRYHEA
TGPLETISQLQKLCHQWLRPEIHSKEQILEMLVLEQFLSILPKETQNWVQKHHPQNVKQA
LVLVEFLQREPDGTKNEVTAHELGKEAVLLGGTAVAPGFKWKPAEPQPMGVFQKEYWNTY
RVLQEQLGWNTHKETQPVYERAVHDQQMLALSEQKRIKHWKMASKLILPESLSLLTFEDV
AVYFSEEEWQLLNPLEKTLYNDVMQDIYETVISLGLKLKNDTGNDHPISVSTSEIQTSGC
EVSKKTRMKIAQKTMGRENPGDTHSVQKWHRAFPRKKRKKPATCKQELPKLMDLHGKGPT
GEKPFKCQECGKSFRVSSDLIKHHRIHTGEKPYKCQQCDRRFRWSSDLNKHFMTHQGIKP
YRCSWCGKSFSHNTNLHTHQRIHTGEKPFKCDECGKRFIQNSHLIKHQRTHTGEQPYTCS
LCKRNFSRRSSLLRHQKLHRRREACLVSPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BRR0	0.291	0.277	6.365E-29	538	0.331	0.314	Q9BRR0.pdb.gz	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
2	AFDB:O14771	0.283	0.312	1.992E-28	459	0.335	0.373	O14771.pdb.gz	ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens OX=9606 GN=ZNF213 PE=1 SV=2
3	AFDB:Q86W11	0.191	0.197	3.075E-28	494	0.314	0.324	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
4	AFDB:Q96GC6	0.261	0.207	3.428E-28	653	0.312	0.243	Q96GC6.pdb.gz	ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens OX=9606 GN=ZNF274 PE=1 SV=2
5	AFDB:O14978	0.223	0.169	4.749E-28	683	0.355	0.265	O14978.pdb.gz	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
6	AFDB:Q9P0L1	0.312	0.220	7.335E-28	754	0.333	0.225	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
7	AFDB:P17029	0.267	0.242	1.569E-27	563	0.353	0.320	P17029.pdb.gz	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
8	AFDB:Q9EQB9	0.258	0.177	1.569E-27	759	0.314	0.211	Q9EQB9.pdb.gz	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
9	AFDB:P49910	0.252	0.264	3.544E-27	485	0.312	0.328	P49910.pdb.gz	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
10	AFDB:Q53GI3	0.255	0.237	3.742E-27	561	0.322	0.292	Q53GI3.pdb.gz	ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens OX=9606 GN=ZNF394 PE=1 SV=2
11	PDB:3w5kB	0.095	0.276	4.346E-4	110	0.080	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:3ismC	0.086	0.141	1.867	286	0.069	0.122	3ismC.pdb.gz
13	PDB:7pksh	0.069	0.046	1.867	887	0.051	0.029	7pksh.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
14	PDB:7kzqE	0.055	0.062	2.883	419	0.084	0.103	7kzqE.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
15	PDB:5gm6a	0.037	0.111	3.214	123	0.033	0.138	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:7pubDJ	0.078	0.099	4.963	357	0.073	0.104	7pubDJ.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
17	PDB:5gm6c	0.066	0.076	5.241	415	0.055	0.067	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:7nacI	0.061	0.059	5.533	533	0.045	0.043	7nacI.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
19	PDB:2lckA	0.066	0.098	5.842	297	0.053	0.091	2lckA.pdb.gz
20	PDB:7dskB	0.088	0.094	6.168	464	0.049	0.054	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96N20	2.24e-134	392	296	0.384	0.662	ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens OX=9606 GN=ZNF75A PE=1 SV=1
2	Q9BRR0	5.79e-91	290	538	0.343	0.325	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
3	A0A0S2Z658	5.35e-90	287	545	0.339	0.317	A0A0S2Z658_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=2 SV=1
4	Q969J2	5.35e-90	287	545	0.339	0.317	ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1
5	Q15776	1.28e-85	277	578	0.353	0.311	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
6	O14771	2.47e-85	273	459	0.343	0.381	ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens OX=9606 GN=ZNF213 PE=1 SV=2
7	P17029	7.88e-85	274	563	0.347	0.314	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
8	Q9P0L1	8.94e-79	263	754	0.335	0.227	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
9	O14978	4.69e-77	257	683	0.363	0.271	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
10	Q86W11	2.64e-76	250	494	0.333	0.344	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
11	P10073	5.52e-75	246	491	0.327	0.340	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
12	O60304	3.21e-74	244	480	0.318	0.338	ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens OX=9606 GN=ZNF500 PE=1 SV=2
13	Q8CF60	2.01e-73	247	680	0.345	0.259	ZN263_MOUSE Zinc finger protein 263 OS=Mus musculus OX=10090 GN=Znf263 PE=1 SV=1
14	Q9Y5A6	7.15e-73	240	473	0.302	0.326	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
15	Q9Y2L8	1.80e-72	248	839	0.294	0.179	ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens OX=9606 GN=ZKSCAN5 PE=1 SV=1
16	Q53GI3	6.55e-72	240	561	0.327	0.298	ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens OX=9606 GN=ZNF394 PE=1 SV=2
17	Q6NSZ9	8.68e-71	237	544	0.312	0.292	ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens OX=9606 GN=ZSCAN25 PE=1 SV=3
18	O95125	1.80e-68	233	648	0.331	0.261	ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens OX=9606 GN=ZNF202 PE=1 SV=4
19	Q9EQB9	3.40e-68	235	759	0.339	0.228	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
20	Q96GC6	6.71e-68	232	653	0.331	0.259	ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens OX=9606 GN=ZNF274 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	0.91	21.1	TFIIH C1-like domain
2	PF12773 DZR	14	17.0	Double zinc ribbon
3	PF01352 KRAB	1.6e-15	67.7	KRAB box
4	PF02023 SCAN	2.5e-34	128.3	SCAN domain
5	PF01428 zf-AN1	1.2e+02	14.2	AN1-like Zinc finger
6	PF00096 zf-C2H2	9.1e-23	90.5	Zinc finger, C2H2 type
7	PF16622 zf-C2H2_11	23	16.2	zinc-finger C2H2-type
8	PF13894 zf-C2H2_4	4.7e-12	56.6	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	0.0011	30.1	C2H2-type zinc finger
10	PF15909 zf-C2H2_8	0.99	21.1	C2H2-type zinc ribbon
11	PF12171 zf-C2H2_jaz	0.0016	29.9	Zinc-finger double-stranded RNA-binding
12	PF13465 zf-H2C2_2	2.7e-24	95.7	Zinc-finger double domain
13	PF13909 zf-H2C2_5	21	16.3	C2H2-type zinc-finger domain
14	PF12874 zf-met	1e+02	14.7	Zinc-finger of C2H2 type
15	PF18439 zf_UBZ	7.6	17.6	Ubiquitin-Binding Zinc Finger
16	PF17032 zinc_ribbon_15	82	15.4	zinc-ribbon family
17	PF09723 Zn-ribbon_8	0.5	21.9	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359802

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256151	0.523	Thyroid transcription factor 1-associated protein 26
2	9606.ENSP00000386764	0.517	Zinc finger CCCH-type containing 6
3	9606.ENSP00000365007	0.504	DnaJ heat shock protein family member C16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.995	sequence-specific double-stranded DNA binding
GO:0140110	0.316	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0080090	0.979	regulation of primary metabolic process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0010468	0.977	regulation of gene expression
GO:0048523	0.937	negative regulation of cellular process
GO:0009892	0.922	negative regulation of metabolic process
GO:2001141	0.918	regulation of RNA biosynthetic process
GO:0006355	0.909	regulation of DNA-templated transcription
GO:0031324	0.875	negative regulation of cellular metabolic process
GO:0045892	0.838	negative regulation of DNA-templated transcription
GO:0009987	0.793	cellular process
GO:0008152	0.409	metabolic process
GO:0071704	0.359	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043228	0.497	non-membrane-bounded organelle
GO:0043232	0.445	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]