StarFunc result for job id P51816

User Input

>input (1311 residues)
MDLFDFFRDWDLEQQCHYEQDRSALKKREWERRNQEVQQEDDLFSSGFDLFGEPYKVAEY
TNKGDALANRVQNTLGNYDEMKNLLTNHSNQNHLVGIPKNSVPQNPNNKNEPSFFPEQKN
RIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPEWSRDSHNPSTVLASQASGQPNK
MQTLTQDQSQAKLEDFFVYPAEQPQIGEVEESNPSAKEDSNPNSSGEDAFKEIFQSNSPE
ESEFAVQAPGSPLVASSLLAPSSGLSVQNFPPGLYCKTSMGQQKPTAYVRPMDGQDQAPD
ISPTLKPSIEFENSFGNLSFGTLLDGKPSAASSKTKLPKFTILQTSEVSLPSDPSCVEEI
LREMTHSWPTPLTSMHTAGHSEQSTFSIPGQESQHLTPGFTLQKWNDPTTRASTKSVSFK
SMLEDDLKLSSDEDDLEPVKTLTTQCTATELYQAVEKAKPRNNPVNPPLATPQPPPAVQA
SGGSGSSSESESSSESDSDTESSTTDSESNEAPRVATPEPEPPSTNKWQLDKWLNKVTSQ
NKSFICGQNETPMETISLPPPIIQPMEVQMKVKTNASQVPAEPKERPLLSLIREKARPRP
TQKIPETKALKHKLSTTSETVSQRTIGKKQPKKVEKNTSTDEFTWPKPNITSSTPKEKES
VELHDPPRGRNKATAHKPAPRKEPRPNIPLAPEKKKYRGPGKIVPKSREFIETDSSTSDS
NTDQEETLQIKVLPPCIISGGNTAKSKEICGASLTLSTLMSSSGSNNNLSISNEEPTFSP
IPVMQTEILSPLRDHENLKNLWVKIDLDLLSRVPGHSSLHAAPAKPDHKETATKPKRQTA
VTAVEKPAPKGKRKHKPIEVAEKIPEKKQRLEEATTICLLPPCISPAPPHKPPNTRENNS
SRRANRRKEEKLFPPPLSPLPEDPPRRRNVSGNNGPFGQDKNIAMTGQITSTKPKRTEGK
FCATFKGISVNEGDTPKKASSATITVTNTAIATATVTATAIVTTTVTATATATATTTTTT
TTISTITSTITTGLMDSSHLEMTSWAALPLLSSSSTNVRRPKLTFDDSVHNADYYMQEAK
KLKHKADALFEKFGKAVNYADAALSFTECGNAMERDPLEAKSPYTMYSETVELLRYAMRL
KNFASPLASDGDKKLAVLCYRCLSLLYLRMFKLKKDHAMKYSRSLMEYFKQNASKVAQIP
SPWVSNGKNTPSPVSLNNVSPINAMGNCNNGPVTIPQRIHHMAASHVNITSNVLRGYEHW
DMADKLTRENKEFFGDLDTLMGPLTQHSSMTNLVRYVRQGLCWLRIDAHLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O55112	0.264	0.270	0.000	1272	0.862	0.888	O55112.pdb.gz	AFF2_MOUSE AF4/FMR2 family member 2 OS=Mus musculus OX=10090 GN=Aff2 PE=2 SV=2
2	AFDB:P51816	1.000	1.000	0.000	1311	1.000	1.000	P51816.pdb.gz	AFF2_HUMAN AF4/FMR2 family member 2 OS=Homo sapiens OX=9606 GN=AFF2 PE=1 SV=4
3	AFDB:P51826	0.204	0.217	9.321E-46	1226	0.382	0.409	P51826.pdb.gz	AFF3_HUMAN AF4/FMR2 family member 3 OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=3
4	AFDB:Q9UHB7	0.211	0.236	1.927E-39	1163	0.358	0.403	Q9UHB7.pdb.gz	AFF4_HUMAN AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
5	AFDB:P51825	0.182	0.197	2.691E-34	1210	0.294	0.318	P51825.pdb.gz	AFF1_HUMAN AF4/FMR2 family member 1 OS=Homo sapiens OX=9606 GN=AFF1 PE=1 SV=1
6	AFDB:O88573	0.179	0.191	1.035E-33	1216	0.297	0.321	O88573.pdb.gz	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
7	AFDB:Q9VQI9	0.174	0.139	1.556E-13	1673	0.211	0.165	Q9VQI9.pdb.gz	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
8	AFDB:Q0DIQ5	0.132	0.117	6.626E-8	1510	0.162	0.141	Q0DIQ5.pdb.gz	CWZF5_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF5 PE=1 SV=1
9	AFDB:F4IZK5	0.138	0.129	1.460E-7	1403	0.153	0.143	F4IZK5.pdb.gz	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
10	AFDB:A0A0P0X9Z7	0.142	0.118	1.841E-7	1600	0.135	0.111	A0A0P0X9Z7.pdb.gz	CWZF7_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF7 PE=1 SV=2
11	PDB:7obqu	0.066	0.170	7.107E-1	441	0.016	0.048	7obqu.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
12	PDB:4nq0A	0.061	0.212	7.445E-1	254	0.022	0.114	4nq0A.pdb.gz
13	PDB:5oobF	0.065	0.102	1.300	718	0.018	0.032	5oobF.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
14	PDB:3feyA	0.060	0.086	1.427	761	0.019	0.033	3feyA.pdb.gz
15	PDB:5dseA	0.052	0.099	1.494	537	0.024	0.058	5dseA.pdb.gz
16	PDB:7vgfA	0.051	0.091	1.566	550	0.023	0.055	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.
17	PDB:1qoyA	0.056	0.179	1.640	303	0.022	0.096	1qoyA.pdb.gz
18	PDB:3msvA	0.060	0.192	1.718	352	0.012	0.045	3msvA.pdb.gz
19	PDB:5njxA	0.052	0.116	1.800	413	0.018	0.056	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
20	PDB:5o9zH	0.048	0.111	1.800	413	0.012	0.039	5o9zH.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55112	0.0	2165	1272	0.859	0.885	AFF2_MOUSE AF4/FMR2 family member 2 OS=Mus musculus OX=10090 GN=Aff2 PE=2 SV=2
2	P51816	0.0	2701	1311	1.000	1.000	AFF2_HUMAN AF4/FMR2 family member 2 OS=Homo sapiens OX=9606 GN=AFF2 PE=1 SV=4
3	H7C4C2	1.53e-104	345	580	0.121	0.274	H7C4C2_HUMAN ALF transcription elongation factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=2
4	P51826	5.07e-104	360	1226	0.249	0.266	AFF3_HUMAN AF4/FMR2 family member 3 OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=3
5	P51827	2.09e-94	333	1254	0.120	0.125	AFF3_MOUSE AF4/FMR2 family member 3 OS=Mus musculus OX=10090 GN=Aff3 PE=1 SV=2
6	Q9UHB7	4.03e-80	290	1163	0.112	0.126	AFF4_HUMAN AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
7	Q9ESC8	8.50e-79	286	1160	0.109	0.123	AFF4_MOUSE AF4/FMR2 family member 4 OS=Mus musculus OX=10090 GN=Aff4 PE=1 SV=1
8	A0A8I6GE44	1.20e-78	285	1130	0.108	0.126	A0A8I6GE44_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=3 SV=1
9	D3ZSX2	1.67e-78	285	1159	0.108	0.123	D3ZSX2_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=1 SV=3
10	A0A8I6GGV9	5.78e-78	283	1120	0.108	0.127	A0A8I6GGV9_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=3 SV=1
11	P51825	7.65e-50	196	1210	0.082	0.088	AFF1_HUMAN AF4/FMR2 family member 1 OS=Homo sapiens OX=9606 GN=AFF1 PE=1 SV=1
12	O88573	1.45e-47	188	1216	0.087	0.094	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
13	Q9VQI9	1.48e-25	117	1673	0.061	0.048	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
14	Q8TAX5	1.22e-19	94.7	365	0.046	0.164	Q8TAX5_HUMAN AFF4 protein OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
15	A0A0P0X9Z7	0.008	43.1	1600	0.026	0.021	CWZF7_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF7 PE=1 SV=2
16	Q0DRX6	0.010	42.7	902	0.024	0.034	CWZF3_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF3 PE=1 SV=1
17	Q9C5C5	0.15	37.7	204	0.024	0.152	TRL4_ARATH Thioredoxin-like 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g07700 PE=2 SV=1
18	F4IZK5	0.22	38.5	1403	0.028	0.026	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
19	Q0DIQ5	0.31	38.1	1510	0.027	0.023	CWZF5_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05110 AF-4	3.6e-169	576.0	AF-4 proto-oncoprotein N-terminal region
2	PF18876 AF-4_C	3.2e-118	405.5	AF-4 proto-oncoprotein C-terminal region
3	PF18875 AF4_int	7e-05	33.6	AF4 interaction motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359489

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359506	0.835	Synaptic functional regulator FMR1
2	9606.ENSP00000471932	0.828	Transmembrane protein 185A
3	9606.ENSP00000360488	0.733	Protein FRA10AC1
4	9606.ENSP00000471604	0.732	Testis-expressed protein 13A
5	9606.ENSP00000398637	0.677	ADP-ribosylation factor-like protein 13A
6	9606.ENSP00000384109	0.647	Cullin-4B
7	9606.ENSP00000331556	0.628	Cylicin-1
8	9606.ENSP00000351327	0.624	A-kinase anchor protein 4
9	9606.ENSP00000250617	0.590	Rho guanine nucleotide exchange factor 6
10	9606.ENSP00000263390	0.583	Mediator of RNA polymerase II transcription subunit 26
11	9606.ENSP00000302770	0.579	Zinc finger protein 296
12	9606.ENSP00000394071	0.570	Rab GDP dissociation inhibitor alpha
13	9606.ENSP00000347710	0.559	Oligophrenin-1
14	9606.ENSP00000367743	0.538	Tetraspanin-7
15	9606.ENSP00000399982	0.530	Transcription initiation factor TFIID subunit 6
16	9606.ENSP00000262809	0.510	RNA polymerase II elongation factor ELL
17	9606.ENSP00000342681	0.503	T-cell surface glycoprotein CD5
18	9606.ENSP00000252674	0.501	Protein ENL

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.774	heterocyclic compound binding
GO:0097159	0.774	organic cyclic compound binding
GO:0003676	0.751	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0032501	0.966	multicellular organismal process
GO:0051171	0.962	regulation of nitrogen compound metabolic process
GO:0080090	0.961	regulation of primary metabolic process
GO:0031323	0.961	regulation of cellular metabolic process
GO:0019219	0.953	regulation of nucleobase-containing compound metabolic process
GO:0032502	0.952	developmental process
GO:0051252	0.944	regulation of RNA metabolic process
GO:0010468	0.940	regulation of gene expression
GO:0043484	0.881	regulation of RNA splicing
GO:0071840	0.687	cellular component organization or biogenesis
GO:0048856	0.661	anatomical structure development
GO:0016043	0.645	cellular component organization
GO:0007275	0.430	multicellular organism development
GO:0048519	0.379	negative regulation of biological process
GO:0071704	0.351	organic substance metabolic process
GO:0044237	0.345	cellular metabolic process
GO:0009889	0.335	regulation of biosynthetic process
GO:0031326	0.333	regulation of cellular biosynthetic process
GO:0010556	0.330	regulation of macromolecule biosynthetic process
GO:0044238	0.329	primary metabolic process
GO:0006355	0.323	regulation of DNA-templated transcription
GO:0006807	0.322	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	0.995	nuclear body
GO:0016607	0.989	nuclear speck
GO:0005737	0.553	cytoplasm
GO:0032991	0.434	protein-containing complex
GO:0005829	0.412	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]