StarFunc result for job id P51825

User Input

>input (1210 residues)
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNM
LGNYEEVKEFLSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPA
SGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGY
CPAKSPKDLAVKVHDKETPQDSLVAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQ
DQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTS
SMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSS
SDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRR
HPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTV
GTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPK
PAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSR
TSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKG
SRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSS
SSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSA
SSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFD
KQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYS
ETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKH
FESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQN
MTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNSSLVDLVHYTRQGF
QQLQELTKTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51825	1.000	1.000	0.000	1210	1.000	1.000	P51825.pdb.gz	AFF1_HUMAN AF4/FMR2 family member 1 OS=Homo sapiens OX=9606 GN=AFF1 PE=1 SV=1
2	AFDB:O88573	0.378	0.376	1.393E-81	1216	0.710	0.706	O88573.pdb.gz	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
3	AFDB:Q9UHB7	0.229	0.237	2.476E-42	1163	0.376	0.391	Q9UHB7.pdb.gz	AFF4_HUMAN AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
4	AFDB:P51827	0.237	0.230	2.964E-37	1254	0.345	0.333	P51827.pdb.gz	AFF3_MOUSE AF4/FMR2 family member 3 OS=Mus musculus OX=10090 GN=Aff3 PE=1 SV=2
5	AFDB:P51826	0.228	0.225	6.156E-37	1226	0.331	0.326	P51826.pdb.gz	AFF3_HUMAN AF4/FMR2 family member 3 OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=3
6	AFDB:P51816	0.194	0.179	4.876E-34	1311	0.326	0.301	P51816.pdb.gz	AFF2_HUMAN AF4/FMR2 family member 2 OS=Homo sapiens OX=9606 GN=AFF2 PE=1 SV=4
7	AFDB:O55112	0.186	0.178	3.179E-31	1272	0.314	0.299	O55112.pdb.gz	AFF2_MOUSE AF4/FMR2 family member 2 OS=Mus musculus OX=10090 GN=Aff2 PE=2 SV=2
8	AFDB:Q9VQI9	0.176	0.129	1.651E-14	1673	0.229	0.166	Q9VQI9.pdb.gz	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
9	AFDB:A0A0P0X9Z7	0.179	0.140	8.951E-9	1600	0.169	0.128	A0A0P0X9Z7.pdb.gz	CWZF7_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF7 PE=1 SV=2
10	AFDB:F4IZK5	0.166	0.145	1.952E-8	1403	0.178	0.153	F4IZK5.pdb.gz	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
11	PDB:4d1eA	0.037	0.047	5.006E-1	859	0.024	0.034	4d1eA.pdb.gz
12	PDB:3hajA	0.052	0.147	1.040	286	0.021	0.087	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
13	PDB:5dseA	0.047	0.079	1.040	537	0.024	0.054	5dseA.pdb.gz
14	PDB:3q15A	0.054	0.135	1.392	365	0.023	0.077	3q15A.pdb.gz	Structural basis of response regulator dephosphorylation by Rap phosphatases.
15	PDB:7qwsK	0.045	0.093	1.612	426	0.028	0.080	7qwsK.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
16	PDB:5wqlA	0.051	0.130	1.777	270	0.025	0.111	5wqlA.pdb.gz	Structural basis of adaptor-mediated protein degradation by the tail-specific PDZ-protease Prc
17	PDB:6c95A	0.053	0.074	1.865	773	0.023	0.036	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
18	PDB:6ygbB	0.098	0.148	2.267	725	0.026	0.043	6ygbB.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
19	PDB:5oobF	0.052	0.072	2.623	718	0.019	0.032	5oobF.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
20	PDB:7l1kB	0.081	0.135	2.623	660	0.025	0.045	7l1kB.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88573	0.0	1341	1216	0.688	0.684	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
2	P51825	0.0	2432	1210	1.000	1.000	AFF1_HUMAN AF4/FMR2 family member 1 OS=Homo sapiens OX=9606 GN=AFF1 PE=1 SV=1
3	D3ZSX2	1.26e-128	426	1159	0.329	0.343	D3ZSX2_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=1 SV=3
4	Q9ESC8	1.95e-126	419	1160	0.329	0.343	AFF4_MOUSE AF4/FMR2 family member 4 OS=Mus musculus OX=10090 GN=Aff4 PE=1 SV=1
5	A0A8I6GGV9	2.14e-77	280	1120	0.220	0.237	A0A8I6GGV9_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=3 SV=1
6	Q9UHB7	1.40e-70	260	1163	0.158	0.164	AFF4_HUMAN AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
7	H7C4C2	5.21e-64	231	580	0.145	0.303	H7C4C2_HUMAN ALF transcription elongation factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=2
8	P51826	4.07e-63	238	1226	0.156	0.154	AFF3_HUMAN AF4/FMR2 family member 3 OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=3
9	P51827	4.04e-60	228	1254	0.155	0.149	AFF3_MOUSE AF4/FMR2 family member 3 OS=Mus musculus OX=10090 GN=Aff3 PE=1 SV=2
10	O55112	1.00e-54	211	1272	0.092	0.087	AFF2_MOUSE AF4/FMR2 family member 2 OS=Mus musculus OX=10090 GN=Aff2 PE=2 SV=2
11	P51816	2.97e-54	210	1311	0.092	0.085	AFF2_HUMAN AF4/FMR2 family member 2 OS=Homo sapiens OX=9606 GN=AFF2 PE=1 SV=4
12	Q8TAX5	1.59e-37	147	365	0.075	0.249	Q8TAX5_HUMAN AFF4 protein OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
13	Q9VQI9	6.70e-18	92.4	1673	0.060	0.044	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
14	A0A8I6GE44	2.94e-17	90.1	1130	0.033	0.035	A0A8I6GE44_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=3 SV=1
15	O80560	4.6	33.9	1316	0.020	0.018	IP5PC_ARATH Type I inositol polyphosphate 5-phosphatase 12 OS=Arabidopsis thaliana OX=3702 GN=IP5P12 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05110 AF-4	8e-196	663.9	AF-4 proto-oncoprotein N-terminal region
2	PF18876 AF-4_C	1.9e-124	425.9	AF-4 proto-oncoprotein C-terminal region
3	PF18875 AF4_int	0.00037	31.3	AF4 interaction motif
4	PF17105 BRD4_CDT	3.9e+02	11.9	C-terminal domain of bromodomain protein 4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378578

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252674	0.998	Protein ENL
2	9606.ENSP00000369695	0.998	Protein AF-9
3	9606.ENSP00000261900	0.994	Cyclin-T1
4	9606.ENSP00000362361	0.992	Cyclin-dependent kinase 9
5	9606.ENSP00000381657	0.990	Histone-lysine N-methyltransferase, H3 lysine-79 specific
6	9606.ENSP00000262809	0.964	RNA polymerase II elongation factor ELL
7	9606.ENSP00000380054	0.961	ELL-associated factor 1
8	9606.ENSP00000237853	0.934	RNA polymerase II elongation factor ELL2
9	9606.ENSP00000307411	0.922	Protein AF-10
10	9606.ENSP00000349156	0.919	E3 ubiquitin-protein ligase SIAH1
11	9606.ENSP00000320346	0.917	RNA polymerase II elongation factor ELL3
12	9606.ENSP00000354255	0.887	Carboxypeptidase Z
13	9606.ENSP00000436786	0.877	Histone-lysine N-methyltransferase 2A
14	9606.ENSP00000265343	0.794	AF4/FMR2 family member 4
15	9606.ENSP00000405890	0.759	Pre-B-cell leukemia transcription factor 1
16	9606.ENSP00000263377	0.753	Bromodomain-containing protein 4
17	9606.ENSP00000328773	0.722	Protein HEXIM1
18	9606.ENSP00000379658	0.716	Transcription factor ETV6
19	9606.ENSP00000343619	0.708	Homeobox protein Hox-A9
20	9606.ENSP00000262965	0.696	Transcription factor E2-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.831	heterocyclic compound binding
GO:0097159	0.830	organic cyclic compound binding
GO:0140110	0.788	transcription regulator activity
GO:0003676	0.719	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0044238	0.982	primary metabolic process
GO:0006355	0.981	regulation of DNA-templated transcription
GO:0009893	0.978	positive regulation of metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:0043170	0.973	macromolecule metabolic process
GO:0044237	0.957	cellular metabolic process
GO:0048522	0.954	positive regulation of cellular process
GO:0010604	0.947	positive regulation of macromolecule metabolic process
GO:0031325	0.930	positive regulation of cellular metabolic process
GO:0051173	0.929	positive regulation of nitrogen compound metabolic process
GO:0051254	0.889	positive regulation of RNA metabolic process
GO:0009891	0.885	positive regulation of biosynthetic process
GO:0010557	0.881	positive regulation of macromolecule biosynthetic process
GO:0045893	0.868	positive regulation of DNA-templated transcription
GO:0090304	0.866	nucleic acid metabolic process
GO:0010467	0.848	gene expression
GO:0034654	0.833	nucleobase-containing compound biosynthetic process
GO:0006351	0.821	DNA-templated transcription
GO:0032502	0.369	developmental process
GO:0032501	0.312	multicellular organismal process
GO:0048856	0.305	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:0140513	0.923	nuclear protein-containing complex
GO:0008023	0.743	transcription elongation factor complex
GO:0005737	0.556	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]