StarFunc result for job id P51826

User Input

>input (1226 residues)
MDSFDLALLQEWDLESLCVYEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFVADSRAQN
QPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQ
PRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDG
QDQAPDESPKLKSSSETSVHCTSYRGVPASKPEPARAKAKLSKFSIPKQGEESRSGETNS
CVEEIIREMTWLPPLSAIQAPGKVEPTKFPFPNKDSQLVSSGHNNPKKGDAEPESPDNGT
SNTSMLEDDLKLSSDEEENEQQAAQRTALRALSDSAVVQQPNCRTSVPSSKGSSSSSSSG
SSSSSSDSESSSGSDSETESSSSESEGSKPPHFSSPEAEPASSNKWQLDKWLNKVNPHKP
PILIQNESHGSESNQYYNPVKEDVQDCGKVPDVCQPSLREKEIKSTCKEEQRPRTANKAP
GSKGVKQKSPPAAVAVAVSAAAPPPAVPCAPAENAPAPARRSAGKKPTRRTERTSAGDGA
NCHRPEEPAAADALGTSVVVPPEPTKTRPCGNNRASHRKELRSSVTCEKRRTRGLSRIVP
KSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQTVAASASSGNDQRLKEAAANGGSGPR
APVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEIRSLWVKIDLTLLSRIPE
HLPQEPGVLSAPATKDSESAPPSHTSDTPAEKALPKSKRKRKCDNEDDYREIKKSQGEKD
SSSRLATSTSNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSS
RPNGNSLFTSASSSKKPKADSQLQPHGGDLTKAAHNNSENIPLHKSRPQTKPWSPGSNGH
RDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQ
GPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKR
DHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMSPNPSPASSVGSQGSLSNAS
ALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVT
LHSSMEHLVQYSQQGLHWLRNSAHLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51826	1.000	1.000	0.000	1226	1.000	1.000	P51826.pdb.gz	AFF3_HUMAN AF4/FMR2 family member 3 OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=3
2	AFDB:P51827	0.319	0.313	0.000	1254	0.883	0.863	P51827.pdb.gz	AFF3_MOUSE AF4/FMR2 family member 3 OS=Mus musculus OX=10090 GN=Aff3 PE=1 SV=2
3	AFDB:P51816	0.217	0.204	1.637E-46	1311	0.409	0.382	P51816.pdb.gz	AFF2_HUMAN AF4/FMR2 family member 2 OS=Homo sapiens OX=9606 GN=AFF2 PE=1 SV=4
4	AFDB:O55112	0.232	0.224	2.345E-42	1272	0.391	0.377	O55112.pdb.gz	AFF2_MOUSE AF4/FMR2 family member 2 OS=Mus musculus OX=10090 GN=Aff2 PE=2 SV=2
5	AFDB:Q9UHB7	0.233	0.245	1.034E-41	1163	0.366	0.386	Q9UHB7.pdb.gz	AFF4_HUMAN AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
6	AFDB:P51825	0.228	0.231	1.059E-37	1210	0.336	0.340	P51825.pdb.gz	AFF1_HUMAN AF4/FMR2 family member 1 OS=Homo sapiens OX=9606 GN=AFF1 PE=1 SV=1
7	AFDB:O88573	0.199	0.201	5.622E-36	1216	0.332	0.335	O88573.pdb.gz	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
8	AFDB:Q9VQI9	0.172	0.129	3.216E-14	1673	0.228	0.167	Q9VQI9.pdb.gz	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
9	AFDB:F4IZK5	0.145	0.129	1.760E-9	1403	0.149	0.130	F4IZK5.pdb.gz	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
10	AFDB:Q0DIQ5	0.125	0.104	3.784E-9	1510	0.163	0.132	Q0DIQ5.pdb.gz	CWZF5_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF5 PE=1 SV=1
11	PDB:7dkhI	0.055	0.071	4.148E-1	914	0.024	0.032	7dkhI.pdb.gz
12	PDB:5jheA	0.061	0.143	6.693E-1	388	0.026	0.082	5jheA.pdb.gz
13	PDB:3msvA	0.069	0.212	8.502E-1	352	0.010	0.034	3msvA.pdb.gz
14	PDB:4i9eA	0.057	0.134	8.502E-1	383	0.024	0.076	4i9eA.pdb.gz	Structural basis of Rap phosphatase inhibition by Phr peptides
15	PDB:5oobF	0.077	0.118	1.188	718	0.020	0.035	5oobF.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
16	PDB:6ip1E	0.055	0.126	1.247	292	0.029	0.123	6ip1E.pdb.gz
17	PDB:1qqeA	0.057	0.168	1.308	281	0.019	0.082	1qqeA.pdb.gz
18	PDB:7r5jB0	0.074	0.055	1.584	1748	0.033	0.023	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:5sv0A	0.053	0.225	1.661	233	0.015	0.077	5sv0A.pdb.gz
20	PDB:7rroA3	0.051	0.148	1.918	334	0.025	0.093	7rroA3.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7C4C2	0.0	1191	580	0.472	0.998	H7C4C2_HUMAN ALF transcription elongation factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=2
2	P51826	0.0	2521	1226	1.000	1.000	AFF3_HUMAN AF4/FMR2 family member 3 OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=3
3	P51827	0.0	2002	1254	0.869	0.850	AFF3_MOUSE AF4/FMR2 family member 3 OS=Mus musculus OX=10090 GN=Aff3 PE=1 SV=2
4	D3ZSX2	5.16e-125	416	1159	0.306	0.324	D3ZSX2_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=1 SV=3
5	P51816	1.79e-109	376	1311	0.263	0.246	AFF2_HUMAN AF4/FMR2 family member 2 OS=Homo sapiens OX=9606 GN=AFF2 PE=1 SV=4
6	A0A8I6GE44	1.66e-106	364	1130	0.294	0.319	A0A8I6GE44_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=3 SV=1
7	O55112	5.29e-100	348	1272	0.131	0.127	AFF2_MOUSE AF4/FMR2 family member 2 OS=Mus musculus OX=10090 GN=Aff2 PE=2 SV=2
8	A0A8I6GGV9	1.46e-92	325	1120	0.217	0.237	A0A8I6GGV9_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=3 SV=1
9	Q9UHB7	3.58e-79	286	1163	0.110	0.116	AFF4_HUMAN AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
10	Q9ESC8	5.16e-76	277	1160	0.106	0.112	AFF4_MOUSE AF4/FMR2 family member 4 OS=Mus musculus OX=10090 GN=Aff4 PE=1 SV=1
11	O88573	1.58e-34	146	1216	0.091	0.092	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
12	Q9VQI9	3.54e-25	116	1673	0.065	0.048	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
13	Q8TAX5	1.34e-23	106	365	0.054	0.181	Q8TAX5_HUMAN AFF4 protein OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
14	P51825	2.80e-18	93.6	1210	0.038	0.039	AFF1_HUMAN AF4/FMR2 family member 1 OS=Homo sapiens OX=9606 GN=AFF1 PE=1 SV=1
15	A0A0P0X9Z7	0.015	42.4	1600	0.028	0.021	CWZF7_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF7 PE=1 SV=2
16	Q0DRX6	0.037	40.8	902	0.024	0.033	CWZF3_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF3 PE=1 SV=1
17	Q0DIQ5	0.042	40.8	1510	0.051	0.041	CWZF5_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF5 PE=1 SV=1
18	F4IZK5	0.51	37.4	1403	0.027	0.024	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05110 AF-4	4.8e-131	450.2	AF-4 proto-oncoprotein N-terminal region
2	PF18876 AF-4_C	4e-115	395.3	AF-4 proto-oncoprotein C-terminal region
3	PF18875 AF4_int	0.01	26.7	AF4 interaction motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386834

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362361	0.808	Cyclin-dependent kinase 9
2	9606.ENSP00000380054	0.798	ELL-associated factor 1
3	9606.ENSP00000369695	0.750	Protein AF-9
4	9606.ENSP00000318406	0.678	Dyslexia-associated protein KIAA0319-like protein
5	9606.ENSP00000222803	0.668	Peptidyl-prolyl cis-trans isomerase FKBP14
6	9606.ENSP00000316512	0.665	Serine/threonine-protein kinase tousled-like 2
7	9606.ENSP00000252674	0.655	Protein ENL
8	9606.ENSP00000378578	0.625	AF4/FMR2 family member 1
9	9606.ENSP00000054668	0.605	Urotensin 2
10	9606.ENSP00000237853	0.604	RNA polymerase II elongation factor ELL2
11	9606.ENSP00000265343	0.604	AF4/FMR2 family member 4
12	9606.ENSP00000320346	0.603	RNA polymerase II elongation factor ELL3
13	9606.ENSP00000262809	0.574	RNA polymerase II elongation factor ELL
14	9606.ENSP00000253363	0.570	RNA-binding protein 39
15	9606.ENSP00000265073	0.540	Activated RNA polymerase II transcriptional coactivator p15
16	9606.ENSP00000350377	0.506	Multiple C2 and transmembrane domain-containing protein 2
17	9606.ENSP00000352833	0.503	Tyrosine-protein phosphatase non-receptor type 22
18	9606.ENSP00000367459	0.502	Dyslexia-associated protein KIAA0319

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003676	0.998	nucleic acid binding
GO:0005515	0.982	protein binding
GO:0003677	0.970	DNA binding
GO:0140110	0.969	transcription regulator activity
GO:0003700	0.928	DNA-binding transcription factor activity
GO:0003690	0.925	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.913	anatomical structure development
GO:0035137	0.895	hindlimb morphogenesis
GO:0035113	0.892	embryonic appendage morphogenesis
GO:0050896	0.880	response to stimulus
GO:0035116	0.871	embryonic hindlimb morphogenesis
GO:0050794	0.866	regulation of cellular process
GO:0009987	0.858	cellular process
GO:0019222	0.582	regulation of metabolic process
GO:0060255	0.549	regulation of macromolecule metabolic process
GO:0031323	0.465	regulation of cellular metabolic process
GO:0071704	0.449	organic substance metabolic process
GO:0044238	0.430	primary metabolic process
GO:0044237	0.421	cellular metabolic process
GO:0080090	0.419	regulation of primary metabolic process
GO:0006807	0.412	nitrogen compound metabolic process
GO:0051171	0.372	regulation of nitrogen compound metabolic process
GO:0010468	0.370	regulation of gene expression
GO:0043170	0.360	macromolecule metabolic process
GO:0051252	0.338	regulation of RNA metabolic process
GO:0042221	0.321	response to chemical
GO:0031326	0.316	regulation of cellular biosynthetic process
GO:2001141	0.306	regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.985	cytosol
GO:0016604	0.958	nuclear body
GO:0032991	0.514	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]