StarFunc result for job id P51828

User Input

>input (1080 residues)
MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIIAFSQGDPS
RHQAILGMAFLVLAVFAALSVLMYVECLLRRWLRALALLTWACLVALGYVLVFDAWTKAA
CAWEQVPFFLFIVFVVYTLLPFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVRVGLQL
LANAVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCQAIKQ
VREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRS
EDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACA
SLIFVCILLVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFSRCCPARGTLCTISER
VETQPLLRLTLAVLTIGSLLTVAIINLPLMPFQVPELPVGNETGLLAASSKTRALCEPLP
YYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCCGQGLGNLTKP
NGTTSGTPSCSWKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAH
IGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
RMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LQT1	0.923	0.907	0.000	1100	0.837	0.822	F1LQT1.pdb.gz	F1LQT1_RAT Adenylate cyclase type 7 OS=Rattus norvegicus OX=10116 GN=Adcy7 PE=3 SV=2
2	AFDB:P51828	1.000	1.000	0.000	1080	1.000	1.000	P51828.pdb.gz	ADCY7_HUMAN Adenylate cyclase type 7 OS=Homo sapiens OX=9606 GN=ADCY7 PE=1 SV=1
3	AFDB:Q29450	0.968	0.970	0.000	1078	0.848	0.850	Q29450.pdb.gz	ADCY7_BOVIN Adenylate cyclase type 7 OS=Bos taurus OX=9913 GN=ADCY7 PE=2 SV=1
4	AFDB:Q08462	0.886	0.877	2.052E-102	1091	0.546	0.541	Q08462.pdb.gz	ADCY2_HUMAN Adenylate cyclase type 2 OS=Homo sapiens OX=9606 GN=ADCY2 PE=1 SV=5
5	AFDB:Q8NFM4	0.882	0.884	8.295E-96	1077	0.527	0.528	Q8NFM4.pdb.gz	ADCY4_HUMAN Adenylate cyclase type 4 OS=Homo sapiens OX=9606 GN=ADCY4 PE=1 SV=1
6	AFDB:P19754	0.732	0.700	4.308E-74	1134	0.369	0.351	P19754.pdb.gz	ADCY1_BOVIN Adenylate cyclase type 1 OS=Bos taurus OX=9913 GN=ADCY1 PE=1 SV=1
7	AFDB:P30803	0.764	0.659	1.717E-73	1265	0.363	0.310	P30803.pdb.gz	ADCY5_CANLF Adenylate cyclase type 5 OS=Canis lupus familiaris OX=9615 GN=ADCY5 PE=1 SV=2
8	AFDB:Q9VW60	0.783	0.654	1.793E-73	1307	0.373	0.308	Q9VW60.pdb.gz	ADCY2_DROME Adenylate cyclase type 2 OS=Drosophila melanogaster OX=7227 GN=Ac76E PE=2 SV=3
9	AFDB:D2CFN3	0.752	0.690	6.847E-73	1186	0.355	0.323	D2CFN3.pdb.gz	D2CFN3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:dkey-178j17.2 PE=2 SV=1
10	AFDB:P84309	0.771	0.665	8.874E-73	1262	0.356	0.305	P84309.pdb.gz	ADCY5_MOUSE Adenylate cyclase type 5 OS=Mus musculus OX=10090 GN=Adcy5 PE=1 SV=2
11	PDB:7yziA	0.196	0.521	8.781E-14	378	0.096	0.275	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
12	PDB:7d9tA	0.185	0.376	5.103E-12	512	0.060	0.127	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
13	PDB:7d9rA	0.198	0.409	7.210E-12	502	0.062	0.133	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
14	PDB:6jt0A	0.190	0.368	3.568E-11	542	0.058	0.116	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
15	PDB:6jt0B	0.188	0.332	7.124E-11	576	0.069	0.130	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
16	PDB:1y11A	0.151	0.406	1.611E-6	364	0.057	0.170	1y11A.pdb.gz
17	PDB:4h54A	0.094	0.316	1.348E-2	274	0.033	0.131	4h54A.pdb.gz	Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
18	PDB:6bfiB	0.089	0.110	1.452E-1	806	0.094	0.125	6bfiB.pdb.gz
19	PDB:3breB	0.104	0.277	1.583E-1	328	0.023	0.076	3breB.pdb.gz	Phosphorylation-independent regulation of the diguanylate cyclase WspR.
20	PDB:5ykeB	0.069	0.082	1.653E-1	845	0.071	0.091	5ykeB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A384P5Q5	643	1261	0.380	0.325	A0A384P5Q5_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 PE=2 SV=1
2	B3KWA8	621	919	0.348	0.409	B3KWA8_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=1
3	B7UCF8	587	1225	0.332	0.293	B7UCF8_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:ch211-220f13.4 PE=2 SV=1
4	C9JRT8	575	820	0.313	0.412	C9JRT8_HUMAN Adenylate cyclase 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=2
5	D2CFN3	633	1186	0.358	0.326	D2CFN3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:dkey-178j17.2 PE=2 SV=1
6	D4A3N4	602	1119	0.359	0.347	D4A3N4_RAT Adenylate cyclase type 1 OS=Rattus norvegicus OX=10116 GN=Adcy1 PE=1 SV=3
7	F1LQT1	1809	1100	0.842	0.826	F1LQT1_RAT Adenylate cyclase type 7 OS=Rattus norvegicus OX=10116 GN=Adcy7 PE=3 SV=2
8	G0TC75	1066	982	0.514	0.565	G0TC75_BOVIN adenylate cyclase OS=Bos taurus OX=9913 GN=ADCY2 PE=2 SV=1
9	O43306	633	1168	0.373	0.345	ADCY6_HUMAN Adenylate cyclase type 6 OS=Homo sapiens OX=9606 GN=ADCY6 PE=1 SV=2
10	O60266	579	1144	0.354	0.334	ADCY3_HUMAN Adenylate cyclase type 3 OS=Homo sapiens OX=9606 GN=ADCY3 PE=1 SV=3
11	O88444	598	1118	0.356	0.344	ADCY1_MOUSE Adenylate cyclase type 1 OS=Mus musculus OX=10090 GN=Adcy1 PE=1 SV=2
12	O95622	643	1261	0.380	0.325	ADCY5_HUMAN Adenylate cyclase type 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=3
13	P19754	604	1134	0.357	0.340	ADCY1_BOVIN Adenylate cyclase type 1 OS=Bos taurus OX=9913 GN=ADCY1 PE=1 SV=1
14	P21932	569	1144	0.356	0.336	ADCY3_RAT Adenylate cyclase type 3 OS=Rattus norvegicus OX=10116 GN=Adcy3 PE=1 SV=1
15	P26769	1166	1090	0.556	0.550	ADCY2_RAT Adenylate cyclase type 2 OS=Rattus norvegicus OX=10116 GN=Adcy2 PE=1 SV=1
16	P26770	998	1064	0.519	0.526	ADCY4_RAT Adenylate cyclase type 4 OS=Rattus norvegicus OX=10116 GN=Adcy4 PE=1 SV=1
17	P30803	643	1265	0.373	0.319	ADCY5_CANLF Adenylate cyclase type 5 OS=Canis lupus familiaris OX=9615 GN=ADCY5 PE=1 SV=2
18	P40145	590	1251	0.338	0.292	ADCY8_HUMAN Adenylate cyclase type 8 OS=Homo sapiens OX=9606 GN=ADCY8 PE=1 SV=1
19	P40146	588	1248	0.339	0.293	ADCY8_RAT Adenylate cyclase type 8 OS=Rattus norvegicus OX=10116 GN=Adcy8 PE=1 SV=1
20	P51828	2240	1080	1.000	1.000	ADCY7_HUMAN Adenylate cyclase type 7 OS=Homo sapiens OX=9606 GN=ADCY7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16214 AC_N	7.8e-19	79.7	Adenylyl cyclase N-terminal extracellular and transmembrane region
2	PF06327 Adcy_cons_dom	6.5e-26	102.2	Adenylate cyclase, conserved domain
3	PF00211 Guanylate_cyc	1.2e-119	408.1	Adenylate and Guanylate cyclase catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378187

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294016	0.983	Adenylate cyclase type 9
2	9606.ENSP00000312126	0.979	Adenylate cyclase type 4
3	9606.ENSP00000334051	0.964	Guanine nucleotide-binding protein G(olf) subunit alpha
4	9606.ENSP00000360141	0.953	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
5	9606.ENSP00000262494	0.947	Guanine nucleotide-binding protein G(o) subunit alpha
6	9606.ENSP00000343027	0.945	Guanine nucleotide-binding protein G(i) subunit alpha-1
7	9606.ENSP00000311405	0.940	Adenylate cyclase type 6
8	9606.ENSP00000312999	0.940	Guanine nucleotide-binding protein G(i) subunit alpha-2
9	9606.ENSP00000419361	0.939	Adenylate cyclase type 5
10	9606.ENSP00000260600	0.932	Adenylate cyclase type 3
11	9606.ENSP00000286355	0.932	Adenylate cyclase type 8
12	9606.ENSP00000297323	0.931	Adenylate cyclase type 1
13	9606.ENSP00000358867	0.930	Guanine nucleotide-binding protein G(k) subunit alpha
14	9606.ENSP00000478892	0.928	Guanine nucleotide-binding protein G(z) subunit alpha
15	9606.ENSP00000315011	0.909	Endothelin-1 receptor
16	9606.ENSP00000306124	0.905	Protein kinase C epsilon type
17	9606.ENSP00000344456	0.904	Catenin beta-1
18	9606.ENSP00000342952	0.903	Adenylate cyclase type 2
19	9606.ENSP00000358404	0.901	Transcription factor 7-like 2
20	9606.ENSP00000368683	0.900	Endothelin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004016	1.000	adenylate cyclase activity
GO:0005488	0.957	binding
GO:0005515	0.827	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006807	0.994	nitrogen compound metabolic process
GO:1901360	0.992	organic cyclic compound metabolic process
GO:0046483	0.992	heterocycle metabolic process
GO:0006725	0.992	cellular aromatic compound metabolic process
GO:0050896	0.990	response to stimulus
GO:0044238	0.990	primary metabolic process
GO:0046058	0.976	cAMP metabolic process
GO:0009190	0.975	cyclic nucleotide biosynthetic process
GO:0009152	0.974	purine ribonucleotide biosynthetic process
GO:0051716	0.964	cellular response to stimulus
GO:0050789	0.959	regulation of biological process
GO:0050794	0.893	regulation of cellular process
GO:0023052	0.713	signaling
GO:0007154	0.713	cell communication
GO:0007165	0.676	signal transduction
GO:0042221	0.533	response to chemical
GO:0032501	0.422	multicellular organismal process
GO:0007186	0.405	G protein-coupled receptor signaling pathway
GO:0006171	0.396	cAMP biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.863	intracellular anatomical structure
GO:0043226	0.622	organelle
GO:0043229	0.568	intracellular organelle
GO:0005737	0.479	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15389	1.000	ATP = 3',5'-cyclic AMP + diphosphate
EC:4.6.1.1	1.000	adenylate cyclase.

[back to server]