StarFunc result for job id P51841

User Input

>input (1108 residues)
MFLGLGRFSRLVLWFAAFRKLLGHHGLASAKFLWCLCLLSVMSLPQQVWTLPYKIGVVGP
WACDSLFSKALPEVAARLAIERINRDPSFDLSYSFEYVILNEDCQTSRALSSFISHHQMA
SGFIGPTNPGYCEAASLLGNSWDKGIFSWACVNYELDNKISYPTFSRTLPSPIRVLVTVM
KYFQWAHAGVISSDEDIWVHTANRVASALRSHGLPVGVVLTTGQDSQSMRKALQRIHQAD
RIRIIIMCMHSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRN
NPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIA
QAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHS
TYTVDMEMELLRFGGTPIHFPGGRPPRADAKCWFAEGKICHGGIDPAFAMMVCLTLLIAL
LSINGFAYFIRRRINKIQLIKGPNRILLTLEDVTFINPHFGSKRGSRASVSFQITSEVQS
GRSPRLSFSSGSLTPATYENSNIAIYEGDWVWLKKFSLGDFGDLKSIKSRASDVFEMMKD
LRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKY
LHHREFVHGRLKSRNCVVDGRFVLKVTDYGFNDILEMLRLSEEESSMEELLWTAPELLRA
PRGSRLGSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAQEIINRLKKPPPVYRPVVPPEHA
PPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIR
ERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMS
EPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDI
LSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPY
RIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLIGKKGFMKPLPVPPPVDKDG
QVGHGLQPVEIAAFQRRKAERQLVRNKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0U1RPR8	0.489	0.485	0.000	1117	0.490	0.486	A0A0U1RPR8.pdb.gz	GUC2D_MOUSE Guanylate cyclase D OS=Mus musculus OX=10090 GN=Gucy2d PE=2 SV=1
2	AFDB:B3DHF2	0.428	0.429	0.000	1107	0.592	0.593	B3DHF2.pdb.gz	B3DHF2_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=2 SV=1
3	AFDB:P51840	0.570	0.570	0.000	1108	0.512	0.512	P51840.pdb.gz	GUC2E_RAT Retinal guanylyl cyclase 1 OS=Rattus norvegicus OX=10116 GN=Gucy2e PE=1 SV=1
4	AFDB:P51841	1.000	1.000	0.000	1108	1.000	1.000	P51841.pdb.gz	GUC2F_HUMAN Retinal guanylyl cyclase 2 OS=Homo sapiens OX=9606 GN=GUCY2F PE=1 SV=2
5	AFDB:P51842	0.570	0.570	0.000	1108	0.898	0.898	P51842.pdb.gz	GUC2F_RAT Retinal guanylyl cyclase 2 OS=Rattus norvegicus OX=10116 GN=Gucy2f PE=1 SV=1
6	AFDB:P55203	0.580	0.580	0.000	1110	0.499	0.498	P55203.pdb.gz	GUC2D_BOVIN Retinal guanylyl cyclase 1 OS=Bos taurus OX=9913 GN=GUCY2D PE=1 SV=1
7	AFDB:Q02846	0.515	0.517	0.000	1103	0.503	0.505	Q02846.pdb.gz	GUC2D_HUMAN Retinal guanylyl cyclase 1 OS=Homo sapiens OX=9606 GN=GUCY2D PE=1 SV=2
8	AFDB:P55205	0.445	0.448	5.111E-84	1100	0.322	0.325	P55205.pdb.gz	GUC2G_RAT Guanylate cyclase 2G OS=Rattus norvegicus OX=10116 GN=Gucy2g PE=2 SV=2
9	AFDB:Q6TL19	0.434	0.437	6.068E-83	1100	0.321	0.324	Q6TL19.pdb.gz	GUC2G_MOUSE Guanylate cyclase 2G OS=Mus musculus OX=10090 GN=Gucy2g PE=1 SV=1
10	AFDB:P16067	0.297	0.313	2.441E-82	1047	0.334	0.353	P16067.pdb.gz	ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1
11	PDB:7d9rA	0.197	0.416	2.772E-20	502	0.091	0.201	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
12	PDB:6jt0A	0.197	0.394	4.970E-19	542	0.089	0.183	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
13	PDB:7d9tA	0.180	0.381	5.901E-18	512	0.088	0.191	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
14	PDB:7yziA	0.179	0.510	9.385E-18	378	0.088	0.257	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
15	PDB:6w2xB	0.266	0.409	2.917E-17	669	0.075	0.124	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
16	PDB:7c7sA	0.275	0.420	1.173E-16	685	0.060	0.096	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
17	PDB:6jt0B	0.197	0.364	1.369E-16	576	0.091	0.175	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
18	PDB:7epaA	0.259	0.347	1.346E-14	782	0.068	0.096	7epaA.pdb.gz
19	PDB:7e9gR	0.267	0.369	3.773E-14	769	0.067	0.096	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
20	PDB:7e9hR	0.253	0.352	2.292E-13	766	0.062	0.090	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RPR8	0.0	1087	1117	0.492	0.488	GUC2D_MOUSE Guanylate cyclase D OS=Mus musculus OX=10090 GN=Gucy2d PE=2 SV=1
2	B3DHF2	0.0	1376	1107	0.591	0.592	B3DHF2_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=2 SV=1
3	F1QWF7	0.0	1397	1103	0.595	0.597	F1QWF7_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=3 SV=2
4	O02740	0.0	2001	1103	0.896	0.900	GUC2F_BOVIN Retinal guanylyl cyclase 2 OS=Bos taurus OX=9913 GN=GUCY2F PE=1 SV=1
5	P51839	0.0	1076	1110	0.486	0.486	GUC2D_RAT Guanylate cyclase 2D OS=Rattus norvegicus OX=10116 GN=Gucy2d PE=1 SV=2
6	P51840	0.0	1104	1108	0.512	0.512	GUC2E_RAT Retinal guanylyl cyclase 1 OS=Rattus norvegicus OX=10116 GN=Gucy2e PE=1 SV=1
7	P51841	0.0	2309	1108	1.000	1.000	GUC2F_HUMAN Retinal guanylyl cyclase 2 OS=Homo sapiens OX=9606 GN=GUCY2F PE=1 SV=2
8	P51842	0.0	2027	1108	0.898	0.898	GUC2F_RAT Retinal guanylyl cyclase 2 OS=Rattus norvegicus OX=10116 GN=Gucy2f PE=1 SV=1
9	P52785	0.0	1080	1108	0.508	0.508	GUC2E_MOUSE Retinal guanylyl cyclase 1 OS=Mus musculus OX=10090 GN=Gucy2e PE=1 SV=2
10	P55203	0.0	1055	1110	0.496	0.495	GUC2D_BOVIN Retinal guanylyl cyclase 1 OS=Bos taurus OX=9913 GN=GUCY2D PE=1 SV=1
11	Q02846	0.0	1041	1103	0.500	0.502	GUC2D_HUMAN Retinal guanylyl cyclase 1 OS=Homo sapiens OX=9606 GN=GUCY2D PE=1 SV=2
12	Q5SDA5	0.0	2012	1108	0.899	0.899	GUC2F_MOUSE Retinal guanylyl cyclase 2 OS=Mus musculus OX=10090 GN=Gucy2f PE=1 SV=1
13	P55205	1.81e-168	528	1100	0.329	0.331	GUC2G_RAT Guanylate cyclase 2G OS=Rattus norvegicus OX=10116 GN=Gucy2g PE=2 SV=2
14	P18293	2.45e-168	526	1057	0.299	0.313	ANPRA_MOUSE Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2
15	P16067	1.46e-167	524	1047	0.319	0.337	ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1
16	Q6VVW5	1.71e-166	521	1047	0.321	0.340	ANPRB_MOUSE Atrial natriuretic peptide receptor 2 OS=Mus musculus OX=10090 GN=Npr2 PE=1 SV=2
17	P18910	4.34e-166	520	1057	0.296	0.310	ANPRA_RAT Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1
18	P20594	2.65e-165	518	1047	0.316	0.334	ANPRB_HUMAN Atrial natriuretic peptide receptor 2 OS=Homo sapiens OX=9606 GN=NPR2 PE=1 SV=1
19	P16066	1.17e-164	516	1061	0.295	0.308	ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1
20	Q1LX84	4.20e-161	507	1067	0.273	0.284	Q1LX84_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=sGC PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	3.2e-66	235.5	Receptor family ligand binding region
2	PF00211 Guanylate_cyc	8.9e-61	216.2	Adenylate and Guanylate cyclase catalytic domain
3	PF07701 HNOBA	0.057	24.4	Heme NO binding associated
4	PF06585 JHBP	2.8e+02	12.0	Haemolymph juvenile hormone binding protein (JHBP)
5	PF14531 Kinase-like	1.7e+02	12.9	Kinase-like
6	PF00069 Pkinase	4.8e-26	103.3	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	2.7e-37	140.0	Protein tyrosine and serine/threonine kinase
8	PF16859 TetR_C_11	1.7e+02	13.9	Tetracyclin repressor-like, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000218006

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377784	0.998	Guanylyl cyclase-activating protein 1
2	9606.ENSP00000230361	0.984	Guanylyl cyclase-activating protein 2
3	9606.ENSP00000261047	0.956	Guanylyl cyclase-activating protein 3
4	9606.ENSP00000251102	0.955	Cyclic nucleotide-gated cation channel beta-1
5	9606.ENSP00000368455	0.901	Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
6	9606.ENSP00000369456	0.900	Inosine triphosphate pyrophosphatase
7	9606.ENSP00000316605	0.830	Cyclic nucleotide-gated cation channel beta-3
8	9606.ENSP00000347046	0.810	cGMP-specific 3',5'-cyclic phosphodiesterase
9	9606.ENSP00000254854	0.809	Retinal guanylyl cyclase 1
10	9606.ENSP00000360502	0.809	Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
11	9606.ENSP00000420295	0.809	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
12	9606.ENSP00000419045	0.804	GTP cyclohydrolase 1
13	9606.ENSP00000362282	0.803	Molybdenum cofactor biosynthesis protein 1
14	9606.ENSP00000255266	0.801	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
15	9606.ENSP00000334910	0.778	cGMP-dependent 3',5'-cyclic phosphodiesterase
16	9606.ENSP00000266395	0.756	Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
17	9606.ENSP00000262844	0.755	AMME syndrome candidate gene 1 protein
18	9606.ENSP00000410309	0.755	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A
19	9606.ENSP00000222214	0.746	Glutaryl-CoA dehydrogenase, mitochondrial
20	9606.ENSP00000328412	0.736	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004383	0.999	guanylate cyclase activity
GO:0005515	0.997	protein binding
GO:0038023	0.698	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.993	cellular process
GO:0032501	0.991	multicellular organismal process
GO:0050794	0.989	regulation of cellular process
GO:0003008	0.968	system process
GO:0050877	0.946	nervous system process
GO:0051716	0.935	cellular response to stimulus
GO:0023052	0.928	signaling
GO:0007154	0.928	cell communication
GO:0050953	0.915	sensory perception of light stimulus
GO:0007165	0.902	signal transduction
GO:0007601	0.839	visual perception
GO:0008152	0.425	metabolic process
GO:0071704	0.354	organic substance metabolic process
GO:0044237	0.321	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.948	membrane-bounded organelle
GO:0120025	0.735	plasma membrane bounded cell projection
GO:0005929	0.720	cilium
GO:0005737	0.719	cytoplasm
GO:0043005	0.717	neuron projection
GO:0001750	0.660	photoreceptor outer segment
GO:0043229	0.412	intracellular organelle
GO:0043231	0.394	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13665	0.999	GTP = 3',5'-cyclic GMP + diphosphate
EC:4.6.1.2	0.999	guanylate cyclase.

[back to server]