StarFunc result for job id P51843

User Input

>input (470 residues)
MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNV
ALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGL
PGGRPVALLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQR
PGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSS
GALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELA
QDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEARKVPSASQVQA
IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQ
GPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1D8P4	0.672	0.672	8.087E-65	470	1.000	1.000	F1D8P4.pdb.gz	F1D8P4_HUMAN Nuclear receptor subfamily 0 group B member 1 OS=Homo sapiens OX=9606 GN=NR0B1 PE=2 SV=1
2	AFDB:Q61066	0.672	0.669	3.317E-46	472	0.655	0.653	Q61066.pdb.gz	NR0B1_MOUSE Nuclear receptor subfamily 0 group B member 1 OS=Mus musculus OX=10090 GN=Nr0b1 PE=1 SV=1
3	AFDB:A1ZA01	0.345	0.280	5.514E-11	582	0.177	0.143	A1ZA01.pdb.gz	A1ZA01_DROME Hormone receptor 51 OS=Drosophila melanogaster OX=7227 GN=Hr51 PE=2 SV=2
4	PDB:1g2nA	0.323	0.583	9.192E-6	246	0.094	0.179	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
5	PDB:3dzyA	0.311	0.464	2.268E-5	302	0.102	0.159	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
6	PDB:6fx0A	0.306	0.571	6.546E-4	238	0.077	0.151	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
7	PDB:7kw7F	0.298	0.507	1.081E-3	259	0.083	0.151	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
8	AFDB:A6YIH7	0.253	0.128	1.568E-3	970	0.145	0.070	A6YIH7.pdb.gz	A6YIH7_DANRE Mineralocorticoid receptor OS=Danio rerio OX=7955 GN=mr PE=2 SV=1
9	AFDB:G1K325	0.268	0.142	1.649E-3	942	0.128	0.064	G1K325.pdb.gz
10	AFDB:E5KQF6	0.259	0.161	6.391E-3	778	0.132	0.080	E5KQF6.pdb.gz	E5KQF6_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=3 SV=1
11	AFDB:D0EWS6	0.293	0.156	2.131E-2	934	0.172	0.087	D0EWS6.pdb.gz	D0EWS6_PIG Progesterone receptor OS=Sus scrofa OX=9823 GN=PGR PE=2 SV=1
12	AFDB:Q84K31	0.062	0.073	2.605E-2	362	0.083	0.108	Q84K31.pdb.gz	Q84K31_ARATH C2H2-type zinc finger family protein OS=Arabidopsis thaliana OX=3702 GN=At5g04390 PE=2 SV=1
13	AFDB:Q68FE6	0.112	0.059	3.892E-2	1223	0.134	0.052	Q68FE6.pdb.gz	RIPR1_MOUSE Rho family-interacting cell polarization regulator 1 OS=Mus musculus OX=10090 GN=Ripor1 PE=1 SV=2
14	AFDB:Q9S7U2	0.095	0.076	1.174E-1	636	0.130	0.096	Q9S7U2.pdb.gz	Q9S7U2_ARATH Uncharacterized protein F24J1.24 OS=Arabidopsis thaliana OX=3702 GN=T6C23.19 PE=4 SV=1
15	PDB:4o7gB	0.086	0.162	1.157	212	0.049	0.108	4o7gB.pdb.gz	Structure and mechanism of a eukaryotic transmembrane ascorbate-dependent oxidoreductase
16	PDB:7be8A	0.075	0.141	1.345	219	0.017	0.037	7be8A.pdb.gz	Repair of Iron Center Proteins-A Different Class of Hemerythrin-like Proteins.
17	PDB:7mq8LT	0.068	0.043	1.345	869	0.053	0.029	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:6zx9C	0.076	0.121	1.564	257	0.074	0.136	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
19	PDB:6nwdA	0.104	0.167	1.644	246	0.051	0.098	6nwdA.pdb.gz	X-ray Crystallographic Structure and Oligomerization of Gloeobacter Rhodopsin.
20	PDB:2k7wA	0.085	0.173	1.729	192	0.047	0.115	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1D8P4	0.0	969	470	1.000	1.000	F1D8P4_HUMAN Nuclear receptor subfamily 0 group B member 1 OS=Homo sapiens OX=9606 GN=NR0B1 PE=2 SV=1
2	P51843	0.0	969	470	1.000	1.000	NR0B1_HUMAN Nuclear receptor subfamily 0 group B member 1 OS=Homo sapiens OX=9606 GN=NR0B1 PE=1 SV=2
3	P70503	0.0	619	472	0.649	0.646	NR0B1_RAT Nuclear receptor subfamily 0 group B member 1 OS=Rattus norvegicus OX=10116 GN=Nr0b1 PE=2 SV=1
4	Q61066	0.0	620	472	0.657	0.655	NR0B1_MOUSE Nuclear receptor subfamily 0 group B member 1 OS=Mus musculus OX=10090 GN=Nr0b1 PE=1 SV=1
5	A3KNP5	3.32e-76	241	264	0.283	0.504	A3KNP5_DANRE LOC100001692 protein OS=Danio rerio OX=7955 GN=LOC100001692 PE=2 SV=1
6	Q15466	2.27e-39	144	257	0.187	0.342	NR0B2_HUMAN Nuclear receptor subfamily 0 group B member 2 OS=Homo sapiens OX=9606 GN=NR0B2 PE=1 SV=2
7	P97947	4.23e-35	133	260	0.198	0.358	NR0B2_RAT Nuclear receptor subfamily 0 group B member 2 OS=Rattus norvegicus OX=10116 GN=Nr0b2 PE=1 SV=1
8	Q62227	7.58e-35	132	260	0.202	0.365	NR0B2_MOUSE Nuclear receptor subfamily 0 group B member 2 OS=Mus musculus OX=10090 GN=Nr0b2 PE=1 SV=1
9	P49116	5.01e-18	89.0	596	0.132	0.104	NR2C2_HUMAN Nuclear receptor subfamily 2 group C member 2 OS=Homo sapiens OX=9606 GN=NR2C2 PE=1 SV=1
10	F2YGU2	5.23e-18	89.0	615	0.132	0.101	F2YGU2_HUMAN Nuclear receptor subfamily 2, group C, member 2, isoform CRA_a OS=Homo sapiens OX=9606 GN=NR2C2 PE=2 SV=1
11	P49117	7.37e-18	88.6	596	0.132	0.104	NR2C2_MOUSE Nuclear receptor subfamily 2 group C member 2 OS=Mus musculus OX=10090 GN=Nr2c2 PE=1 SV=1
12	Q26622	3.09e-17	86.7	583	0.138	0.111	SHR2_STRPU Orphan steroid hormone receptor 2 OS=Strongylocentrotus purpuratus OX=7668 GN=SHR2 PE=1 SV=1
13	Q5U3F3	2.60e-16	83.2	419	0.121	0.136	Q5U3F3_DANRE Nuclear receptor subfamily 2, group E, member 3 OS=Danio rerio OX=7955 GN=zgc:103631 PE=2 SV=1
14	Q9Y5X4	3.39e-16	82.4	410	0.121	0.139	NR2E3_HUMAN Photoreceptor-specific nuclear receptor OS=Homo sapiens OX=9606 GN=NR2E3 PE=1 SV=1
15	O09017	6.75e-16	81.6	390	0.128	0.154	NR2F6_RAT Nuclear receptor subfamily 2 group F member 6 OS=Rattus norvegicus OX=10116 GN=Nr2f6 PE=2 SV=1
16	P16375	3.39e-15	80.1	543	0.119	0.103	7UP1_DROME Steroid receptor seven-up, isoforms B/C OS=Drosophila melanogaster OX=7227 GN=svp PE=1 SV=1
17	Q62681	3.91e-15	79.3	419	0.123	0.138	Q62681_RAT Orphan receptor COUP-TFI OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=2 SV=1
18	F1DAL9	4.32e-15	79.0	398	0.126	0.148	F1DAL9_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
19	Q90733	4.42e-15	79.3	410	0.126	0.144	COT2_CHICK COUP transcription factor 2 OS=Gallus gallus OX=9031 GN=NR2F2 PE=2 SV=1
20	P10589	5.05e-15	79.0	423	0.126	0.139	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	5.7e-11	54.0	Ligand-binding domain of nuclear hormone receptor
2	PF14046 NR_Repeat	1.1e-99	337.7	Nuclear receptor repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368253

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362690	0.999	Steroidogenic factor 1
2	9606.ENSP00000363822	0.988	Androgen receptor
3	9606.ENSP00000229307	0.971	Homeobox protein NANOG
4	9606.ENSP00000405330	0.968	Estrogen receptor
5	9606.ENSP00000343925	0.947	Estrogen receptor beta
6	9606.ENSP00000268712	0.946	Nuclear receptor corepressor 1
7	9606.ENSP00000259915	0.938	POU domain, class 5, transcription factor 1
8	9606.ENSP00000356331	0.892	Nuclear receptor subfamily 5 group A member 2
9	9606.ENSP00000217086	0.833	Sal-like protein 4
10	9606.ENSP00000331327	0.818	Wilms tumor protein
11	9606.ENSP00000422488	0.816	Steroid hormone receptor ERR2
12	9606.ENSP00000221496	0.810	Muellerian-inhibiting factor
13	9606.ENSP00000333188	0.795	Forkhead box protein L2
14	9606.ENSP00000355904	0.789	Estrogen-related receptor gamma
15	9606.ENSP00000356520	0.789	ATP-dependent RNA helicase A
16	9606.ENSP00000400142	0.783	RNA-binding protein EWS
17	9606.ENSP00000245479	0.781	Transcription factor SOX-9
18	9606.ENSP00000371711	0.768	Doublesex- and mab-3-related transcription factor 1
19	9606.ENSP00000256999	0.759	Glutamate carboxypeptidase 2
20	9606.ENSP00000399968	0.753	Nuclear receptor coactivator 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	0.999	transcription factor binding
GO:0003714	0.999	transcription corepressor activity
GO:0003677	0.999	DNA binding
GO:0003723	0.997	RNA binding
GO:0043565	0.779	sequence-specific DNA binding
GO:0003690	0.621	double-stranded DNA binding
GO:1990837	0.341	sequence-specific double-stranded DNA binding
GO:0003700	0.300	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0080090	0.981	regulation of primary metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0032502	0.977	developmental process
GO:0031326	0.975	regulation of cellular biosynthetic process
GO:0032501	0.973	multicellular organismal process
GO:0006355	0.971	regulation of DNA-templated transcription
GO:0048523	0.966	negative regulation of cellular process
GO:0009892	0.960	negative regulation of metabolic process
GO:0048856	0.943	anatomical structure development
GO:1903507	0.927	negative regulation of nucleic acid-templated transcription
GO:0045892	0.924	negative regulation of DNA-templated transcription
GO:0022414	0.920	reproductive process
GO:0050810	0.920	regulation of steroid biosynthetic process
GO:0007275	0.908	multicellular organism development
GO:0065009	0.882	regulation of molecular function
GO:0003006	0.852	developmental process involved in reproduction
GO:0048731	0.817	system development
GO:0051090	0.792	regulation of DNA-binding transcription factor activity
GO:0048583	0.758	regulation of response to stimulus
GO:0046661	0.748	male sex differentiation
GO:0048513	0.727	animal organ development
GO:0045137	0.721	development of primary sexual characteristics
GO:0043433	0.717	negative regulation of DNA-binding transcription factor activity
GO:0023051	0.716	regulation of signaling
GO:0010646	0.703	regulation of cell communication
GO:0006357	0.692	regulation of transcription by RNA polymerase II
GO:0008584	0.691	male gonad development
GO:0033143	0.672	regulation of intracellular steroid hormone receptor signaling pathway
GO:0050896	0.626	response to stimulus
GO:0035270	0.604	endocrine system development
GO:0030325	0.558	adrenal gland development
GO:0048518	0.381	positive regulation of biological process
GO:0048522	0.333	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0032991	0.989	protein-containing complex
GO:0005737	0.959	cytoplasm
GO:0005813	0.927	centrosome
GO:0034451	0.901	centriolar satellite
GO:0016604	0.871	nuclear body
GO:0016020	0.845	membrane
GO:0016607	0.826	nuclear speck
GO:1990904	0.523	ribonucleoprotein complex
GO:0005840	0.508	ribosome
GO:0042788	0.431	polysomal ribosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]