StarFunc result for job id P51854

User Input

>input (596 residues)
MADAEARAEFPEEARPDRGTLQVLQDMASRLRIHSIRATCSTSSGHPTSCSSSSEIMSVL
FFYIMRYKQSDPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRV
FCLMSDGESSEGSVWEAMAFASYYSLDNLVAIFDVNRLGHSGALPAEHCINIYQRRCEAF
GWNTYVVDGRDVEALCQVFWQASQVKHKPTAVVAKTFKGRGTPSIEDAESWHAKPMPRER
ADAIIKLIESQIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA
KLGYANNRVVVLDGDTRYSTFSEIFNKEYPERFIECFMAEQNMVSVALGCASRGRTIAFA
STFAAFLTRAFDHIRIGGLAESNINIIGSHCGVSVGDDGASQMALEDIAMFRTIPKCTIF
YPTDAVSTEHAVALAANAKGMCFIRTTRPETMVIYTPQERFEIGQAKVLRHCVSDKVTVI
GAGITVYEALAAADELSKQDIFIRVIDLFTIKPLDVATIVSSAKATEGRIITVEDHYPQG
GIGEAVCAAVSMDPDIQVHSLAVSGVPQSGKSEELLDMYGISARHIIVAVKCMLLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51854	1.000	1.000	0.000	596	1.000	1.000	P51854.pdb.gz	TKTL1_HUMAN Transketolase-like protein 1 OS=Homo sapiens OX=9606 GN=TKTL1 PE=1 SV=2
2	AFDB:Q9H0I9	0.972	0.926	5.151E-94	626	0.737	0.701	Q9H0I9.pdb.gz	TKTL2_HUMAN Transketolase-like protein 2 OS=Homo sapiens OX=9606 GN=TKTL2 PE=2 SV=1
3	AFDB:P29401	0.953	0.912	1.353E-85	623	0.617	0.591	P29401.pdb.gz	TKT_HUMAN Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3
4	PDB:6rjbB	0.955	0.916	2.183E-82	622	0.614	0.588	6rjbB.pdb.gz	Low-barrier hydrogen bonds in enzyme cooperativity.
5	AFDB:Q9VHN7	0.962	0.917	2.408E-79	626	0.545	0.519	Q9VHN7.pdb.gz	Q9VHN7_DROME LP07963p OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.344 PE=1 SV=3
6	AFDB:A0A0I9QGZ2	0.823	0.737	2.528E-39	668	0.213	0.190	A0A0I9QGZ2.pdb.gz	TKT_GEOSE Transketolase OS=Geobacillus stearothermophilus OX=1422 GN=tkt PE=1 SV=1
7	AFDB:P27302	0.796	0.718	7.014E-39	663	0.230	0.207	P27302.pdb.gz	TKT1_ECOLI Transketolase 1 OS=Escherichia coli (strain K12) OX=83333 GN=tktA PE=1 SV=5
8	AFDB:Q57YL8	0.800	0.715	8.240E-39	669	0.240	0.214	Q57YL8.pdb.gz	Q57YL8_TRYB2 Transketolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.550 PE=3 SV=1
9	AFDB:P33570	0.801	0.718	7.450E-38	667	0.225	0.201	P33570.pdb.gz	TKT2_ECOLI Transketolase 2 OS=Escherichia coli (strain K12) OX=83333 GN=tktB PE=1 SV=1
10	PDB:5hhtB	0.817	0.733	1.911E-37	667	0.225	0.201	5hhtB.pdb.gz	Structural Analysis of an Evolved Transketolase Reveals Divergent Binding Modes.
11	AFDB:C8VRQ4	0.792	0.693	1.959E-37	684	0.243	0.212	C8VRQ4.pdb.gz	C8VRQ4_EMENI Transketolase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00688 PE=3 SV=1
12	AFDB:Q4QAC4	0.802	0.715	2.428E-37	671	0.228	0.203	Q4QAC4.pdb.gz	Q4QAC4_LEIMA Transketolase OS=Leishmania major OX=5664 GN=LMJF_24_2060 PE=3 SV=1
13	PDB:1itzA	0.811	0.730	2.384E-36	666	0.227	0.203	1itzA.pdb.gz	Structure and properties of an engineered transketolase from maize
14	PDB:3rimA	0.782	0.677	4.106E-35	694	0.225	0.193	3rimA.pdb.gz	Structure and function of the transketolase from Mycobacterium tuberculosis and comparison with the human enzyme.
15	PDB:1ay0A	0.772	0.681	4.133E-34	678	0.223	0.196	1ay0A.pdb.gz	Identification of catalytically important residues in yeast transketolase.
16	PDB:2o1sA	0.487	0.540	3.136E-27	536	0.200	0.222	2o1sA.pdb.gz	Crystal Structure of 1-Deoxy-D-xylulose 5-Phosphate Synthase, a Crucial Enzyme for Isoprenoids Biosynthesis.
17	PDB:2o1sB	0.490	0.588	3.309E-27	493	0.183	0.221	2o1sB.pdb.gz	Crystal Structure of 1-Deoxy-D-xylulose 5-Phosphate Synthase, a Crucial Enzyme for Isoprenoids Biosynthesis.
18	PDB:2g25B	0.784	0.573	4.102E-27	831	0.211	0.152	2g25B.pdb.gz	A Thiamin-bound, Pre-decarboxylation Reaction Intermediate Analogue in the Pyruvate Dehydrogenase E1 Subunit Induces Large Scale Disorder-to-Order Transformations in the Enzyme and Reveals Novel Structural Features in the Covalently Bound Adduct.
19	PDB:2g28B	0.770	0.585	1.411E-26	801	0.201	0.150	2g28B.pdb.gz	A Thiamin-bound, Pre-decarboxylation Reaction Intermediate Analogue in the Pyruvate Dehydrogenase E1 Subunit Induces Large Scale Disorder-to-Order Transformations in the Enzyme and Reveals Novel Structural Features in the Covalently Bound Adduct.
20	PDB:7bzy11	0.477	0.487	1.508E-24	584	0.190	0.193	7bzy11.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29401	0.0	771	623	0.619	0.592	TKT_HUMAN Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3
2	P40142	0.0	780	623	0.621	0.594	TKT_MOUSE Transketolase OS=Mus musculus OX=10090 GN=Tkt PE=1 SV=1
3	P50137	0.0	773	623	0.612	0.586	TKT_RAT Transketolase OS=Rattus norvegicus OX=10116 GN=Tkt PE=1 SV=1
4	P51854	0.0	1239	596	1.000	1.000	TKTL1_HUMAN Transketolase-like protein 1 OS=Homo sapiens OX=9606 GN=TKTL1 PE=1 SV=2
5	Q7KSU6	0.0	606	580	0.505	0.519	Q7KSU6_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.344 PE=1 SV=1
6	Q9H0I9	0.0	901	626	0.735	0.700	TKTL2_HUMAN Transketolase-like protein 2 OS=Homo sapiens OX=9606 GN=TKTL2 PE=2 SV=1
7	Q9VHN7	0.0	658	626	0.545	0.519	Q9VHN7_DROME LP07963p OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.344 PE=1 SV=3
8	V9HWD9	0.0	771	623	0.619	0.592	V9HWD9_HUMAN Epididymis luminal protein 107 OS=Homo sapiens OX=9606 GN=HEL107 PE=2 SV=1
9	A2ID95	3.39e-109	327	197	0.255	0.772	A2ID95_HUMAN Transketolase-like 1 (Fragment) OS=Homo sapiens OX=9606 GN=TKTL1 PE=1 SV=1
10	H0Y808	3.11e-105	316	175	0.255	0.869	H0Y808_HUMAN Transketolase like 1 (Fragment) OS=Homo sapiens OX=9606 GN=TKTL1 PE=1 SV=1
11	Q95S19	3.16e-84	264	221	0.215	0.579	Q95S19_DROME HL01241p OS=Drosophila melanogaster OX=7227 GN=CG8036 PE=2 SV=1
12	Q57YL8	1.14e-31	132	669	0.265	0.236	Q57YL8_TRYB2 Transketolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.550 PE=3 SV=1
13	C8VRQ4	2.07e-30	129	684	0.248	0.216	C8VRQ4_EMENI Transketolase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00688 PE=3 SV=1
14	Q9URM2	1.75e-27	119	685	0.206	0.180	TKT_SCHPO Probable transketolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G5.05 PE=2 SV=1
15	P33570	2.45e-26	116	667	0.257	0.229	TKT2_ECOLI Transketolase 2 OS=Escherichia coli (strain K12) OX=83333 GN=tktB PE=1 SV=1
16	P27302	1.14e-24	110	663	0.248	0.223	TKT1_ECOLI Transketolase 1 OS=Escherichia coli (strain K12) OX=83333 GN=tktA PE=1 SV=5
17	P9WG25	3.47e-23	106	700	0.218	0.186	TKT_MYCTU Transketolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tkt PE=1 SV=1
18	A0A0I9QGZ2	3.28e-22	103	668	0.215	0.192	TKT_GEOSE Transketolase OS=Geobacillus stearothermophilus OX=1422 GN=tkt PE=1 SV=1
19	Q4QAC4	3.33e-22	103	671	0.258	0.230	Q4QAC4_LEIMA Transketolase OS=Leishmania major OX=5664 GN=LMJF_24_2060 PE=3 SV=1
20	P23254	7.99e-22	102	680	0.235	0.206	TKT1_YEAST Transketolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TKL1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13292 DXP_synthase_N	37	15.0	1-deoxy-D-xylulose-5-phosphate synthase
2	PF00676 E1_dh	0.0032	28.1	Dehydrogenase E1 component
3	PF02780 Transketolase_C	4.1e-28	109.2	Transketolase, C-terminal domain
4	PF00456 Transketolase_N	3.8e-24	96.9	Transketolase, thiamine diphosphate binding domain
5	PF02779 Transket_pyr	1.6e-33	127.4	Transketolase, pyrimidine binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358931

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321259	0.994	Transaldolase
2	9606.ENSP00000283646	0.988	Ribose 5-phosphate isomerase A
3	9606.ENSP00000352401	0.986	Ribulose-phosphate 3-epimerase
4	9606.ENSP00000476672	0.984	Ribulose-phosphate 3-epimerase-like protein 1
5	9606.ENSP00000229270	0.973	Triosephosphate isomerase 1
6	9606.ENSP00000405573	0.960	Glucose-6-phosphate isomerase
7	9606.ENSP00000416583	0.952	Deoxyribose-phosphate aldolase
8	9606.ENSP00000226253	0.950	Belongs to the class I fructose-bisphosphate aldolase family
9	9606.ENSP00000306817	0.950	Ribokinase
10	9606.ENSP00000378669	0.947	Fructose-bisphosphate aldolase A
11	9606.ENSP00000363988	0.946	Belongs to the class I fructose-bisphosphate aldolase family
12	9606.ENSP00000345771	0.943	ATP-dependent 6-phosphofructokinase, muscle type
13	9606.ENSP00000473348	0.937	GDH/6PGL endoplasmic bifunctional protein
14	9606.ENSP00000364486	0.936	Fructose-1,6-bisphosphatase isozyme 2
15	9606.ENSP00000408025	0.936	Fructose-1,6-bisphosphatase 1
16	9606.ENSP00000381504	0.935	Ribose-phosphate pyrophosphokinase 2
17	9606.ENSP00000269848	0.930	ATP-dependent 6-phosphofructokinase, liver type
18	9606.ENSP00000424595	0.930	Ribose-phosphate pyrophosphokinase 3
19	9606.ENSP00000361512	0.929	Ribose-phosphate pyrophosphokinase 1
20	9606.ENSP00000370517	0.929	ATP-dependent 6-phosphofructokinase, platelet type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004802	1.000	transketolase activity
GO:0005488	0.989	binding
GO:0005515	0.968	protein binding
GO:0043167	0.445	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044281	0.992	small molecule metabolic process
GO:1901564	0.987	organonitrogen compound metabolic process
GO:1901360	0.983	organic cyclic compound metabolic process
GO:0046483	0.982	heterocycle metabolic process
GO:0034641	0.982	cellular nitrogen compound metabolic process
GO:0006725	0.966	cellular aromatic compound metabolic process
GO:0006139	0.652	nucleobase-containing compound metabolic process
GO:0019637	0.627	organophosphate metabolic process
GO:0006796	0.625	phosphate-containing compound metabolic process
GO:1901135	0.612	carbohydrate derivative metabolic process
GO:0009117	0.573	nucleotide metabolic process
GO:0072521	0.572	purine-containing compound metabolic process
GO:0006163	0.547	purine nucleotide metabolic process
GO:0006091	0.508	generation of precursor metabolites and energy
GO:0005975	0.405	carbohydrate metabolic process
GO:0009056	0.371	catabolic process
GO:1901575	0.360	organic substance catabolic process
GO:0005996	0.338	monosaccharide metabolic process
GO:0072524	0.338	pyridine-containing compound metabolic process
GO:0009058	0.331	biosynthetic process
GO:0019318	0.316	hexose metabolic process
GO:0065007	0.309	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.844	intracellular organelle
GO:0043231	0.415	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10508	1.000	D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate
EC:2.2.1.1	1.000	transketolase.

[back to server]