StarFunc result for job id P51857

User Input

>input (326 residues)
MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQN
EHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIE
VPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELIL
NKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLK
DALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIE
ALNKNVRFVELLMWRDHPEYPFHDEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51857	1.000	1.000	1.565E-70	326	1.000	1.000	P51857.pdb.gz	AK1D1_HUMAN Aldo-keto reductase family 1 member D1 OS=Homo sapiens OX=9606 GN=AKR1D1 PE=1 SV=1
2	PDB:3burA	0.992	0.995	2.255E-64	325	0.997	1.000	3burA.pdb.gz	Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
3	AFDB:H0ZPZ0	0.997	0.997	8.821E-62	326	0.804	0.804	H0ZPZ0.pdb.gz	H0ZPZ0_TAEGU Aldo-keto reductase family 1 member D1 OS=Taeniopygia guttata OX=59729 GN=AKR1D1 PE=3 SV=2
4	AFDB:P31210	0.988	0.988	3.226E-59	326	0.798	0.798	P31210.pdb.gz	AK1D1_RAT Aldo-keto reductase family 1 member D1 OS=Rattus norvegicus OX=10116 GN=Akr1d1 PE=1 SV=1
5	AFDB:P70694	0.978	0.987	1.738E-52	323	0.583	0.588	P70694.pdb.gz	DHB5_MOUSE Estradiol 17 beta-dehydrogenase 5 OS=Mus musculus OX=10090 GN=Akr1c6 PE=1 SV=1
6	AFDB:Q1HE49	0.967	0.979	9.225E-52	322	0.558	0.565	Q1HE49.pdb.gz	Q1HE49_PIG Aldo-keto reductase family 1 member C4 OS=Sus scrofa OX=9823 GN=AKR1C4 PE=3 SV=1
7	AFDB:P52895	0.979	0.988	1.777E-51	323	0.567	0.573	P52895.pdb.gz	AK1C2_HUMAN Aldo-keto reductase family 1 member C2 OS=Homo sapiens OX=9606 GN=AKR1C2 PE=1 SV=3
8	AFDB:P17516	0.978	0.987	2.125E-51	323	0.555	0.560	P17516.pdb.gz	AK1C4_HUMAN Aldo-keto reductase family 1 member C4 OS=Homo sapiens OX=9606 GN=AKR1C4 PE=1 SV=3
9	AFDB:D3ZF77	0.969	0.975	7.889E-51	324	0.555	0.559	D3ZF77.pdb.gz	AK1CA_RAT Aldo-keto reductase family 1 member C15 OS=Rattus norvegicus OX=10116 GN=Akr1c15 PE=1 SV=1
10	AFDB:P42330	0.976	0.985	8.374E-51	323	0.546	0.551	P42330.pdb.gz	AK1C3_HUMAN Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3 PE=1 SV=4
11	AFDB:P51652	0.970	0.979	8.888E-51	323	0.534	0.539	P51652.pdb.gz	AKC1H_RAT Aldo-keto reductase family 1 member C18 OS=Rattus norvegicus OX=10116 GN=Akr1c18 PE=1 SV=1
12	PDB:3cv6A	0.959	0.968	4.411E-50	323	0.555	0.560	3cv6A.pdb.gz	Structure of the G225P/G226P mutant of mouse 3(17)alpha-hydroxysteroid dehydrogenase (AKR1C21) ternary complex: implications for the binding of inhibitor and substrate.
13	PDB:2fvlA	0.974	0.983	8.499E-50	323	0.555	0.560	2fvlA.pdb.gz	Crystal structure of human 3-alpha hydroxysteroid/dihydrodiol dehydrogenase (AKR1C4) complexed with NADP+
14	PDB:4l1wA	0.962	0.965	2.078E-49	325	0.567	0.569	4l1wA.pdb.gz	Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
15	PDB:4zfcB	0.949	0.967	1.777E-48	320	0.537	0.547	4zfcB.pdb.gz	In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
16	PDB:1afsA	0.950	0.971	3.501E-47	319	0.537	0.549	1afsA.pdb.gz	Steroid recognition and regulation of hormone action: crystal structure of testosterone and NADP+ bound to 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase.
17	PDB:3ln3A	0.954	0.974	1.024E-46	319	0.512	0.524	3ln3A.pdb.gz	Crystal structure of Putative reductase (NP_038806.2) from MUS MUSCULUS at 1.18 A resolution
18	PDB:4gq0A	0.929	0.952	1.725E-44	318	0.494	0.506	4gq0A.pdb.gz	Crystal structure of AKR1B10 complexed with NADP+ and Caffeic acid phenethyl ester
19	PDB:3rx2A	0.940	0.963	1.764E-43	318	0.491	0.503	3rx2A.pdb.gz	The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase
20	PDB:3o3rA	0.935	0.967	1.215E-41	315	0.479	0.495	3o3rA.pdb.gz	Structure of rat aldose reductase-like protein AKR1B14 holoenzyme: Probing the role of His269 in coenzyme binding by site-directed mutagenesis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0ZPZ0	0.0	580	326	0.804	0.804	H0ZPZ0_TAEGU Aldo-keto reductase family 1 member D1 OS=Taeniopygia guttata OX=59729 GN=AKR1D1 PE=3 SV=2
2	P31210	0.0	551	326	0.798	0.798	AK1D1_RAT Aldo-keto reductase family 1 member D1 OS=Rattus norvegicus OX=10116 GN=Akr1d1 PE=1 SV=1
3	P51857	0.0	681	326	1.000	1.000	AK1D1_HUMAN Aldo-keto reductase family 1 member D1 OS=Homo sapiens OX=9606 GN=AKR1D1 PE=1 SV=1
4	P70694	1.54e-143	409	323	0.583	0.588	DHB5_MOUSE Estradiol 17 beta-dehydrogenase 5 OS=Mus musculus OX=10090 GN=Akr1c6 PE=1 SV=1
5	Q04828	1.83e-141	404	323	0.571	0.576	AK1C1_HUMAN Aldo-keto reductase family 1 member C1 OS=Homo sapiens OX=9606 GN=AKR1C1 PE=1 SV=1
6	P52895	2.64e-140	401	323	0.567	0.573	AK1C2_HUMAN Aldo-keto reductase family 1 member C2 OS=Homo sapiens OX=9606 GN=AKR1C2 PE=1 SV=3
7	Q2TJA5	3.21e-140	401	322	0.564	0.571	Q2TJA5_PIG Aldo-keto reductase OS=Sus scrofa OX=9823 GN=AKR1C8 PE=1 SV=1
8	Q1HE49	3.82e-140	401	322	0.561	0.568	Q1HE49_PIG Aldo-keto reductase family 1 member C4 OS=Sus scrofa OX=9823 GN=AKR1C4 PE=3 SV=1
9	D3ZF77	3.57e-139	399	324	0.564	0.568	AK1CA_RAT Aldo-keto reductase family 1 member C15 OS=Rattus norvegicus OX=10116 GN=Akr1c15 PE=1 SV=1
10	P17516	3.71e-137	393	323	0.555	0.560	AK1C4_HUMAN Aldo-keto reductase family 1 member C4 OS=Homo sapiens OX=9606 GN=AKR1C4 PE=1 SV=3
11	P42330	3.98e-136	390	323	0.546	0.551	AK1C3_HUMAN Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3 PE=1 SV=4
12	Q91WR5	1.55e-134	387	323	0.552	0.557	AK1CL_MOUSE Aldo-keto reductase family 1 member C21 OS=Mus musculus OX=10090 GN=Akr1c21 PE=1 SV=2
13	Q8K023	2.65e-133	384	323	0.531	0.536	AKC1H_MOUSE Aldo-keto reductase family 1 member C18 OS=Mus musculus OX=10090 GN=Akr1c18 PE=1 SV=2
14	P51652	2.93e-133	384	323	0.531	0.536	AKC1H_RAT Aldo-keto reductase family 1 member C18 OS=Rattus norvegicus OX=10116 GN=Akr1c18 PE=1 SV=1
15	Q3MHS3	3.00e-132	381	323	0.549	0.554	Q3MHS3_RAT Aldo-keto reductase family 1, member C1 OS=Rattus norvegicus OX=10116 GN=Akr1c1 PE=1 SV=1
16	Q91WT7	3.24e-132	381	323	0.537	0.542	Q91WT7_MOUSE 3-alpha-hydroxysteroid dehydrogenase type 1 OS=Mus musculus OX=10090 GN=Akr1c14 PE=1 SV=1
17	Q5I0L1	6.30e-132	380	322	0.549	0.556	Q5I0L1_RAT Akr1c1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Akr1c1 PE=2 SV=1
18	P23457	1.27e-131	379	322	0.537	0.543	DIDH_RAT 3-alpha-hydroxysteroid dehydrogenase OS=Rattus norvegicus OX=10116 GN=Akr1c9 PE=1 SV=1
19	Q9JLI0	3.60e-123	358	323	0.521	0.526	Q9JLI0_MOUSE Aldo-keto reductase a OS=Mus musculus OX=10090 GN=Akr1c12 PE=1 SV=1
20	Q91X42	4.15e-123	358	323	0.521	0.526	Q91X42_MOUSE Aldo-keto reductase family 1, member C12 OS=Mus musculus OX=10090 GN=Akr1c12 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00248 Aldo_ket_red	2e-43	160.1	Aldo/keto reductase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242375

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297679	0.991	3 beta-hydroxysteroid dehydrogenase type 7
2	9606.ENSP00000370254	0.987	Aldo-keto reductase family 1 member C1
3	9606.ENSP00000477587	0.976	3-oxo-5-alpha-steroid 4-dehydrogenase 2
4	9606.ENSP00000369927	0.975	Aldo-keto reductase family 1 member C3
5	9606.ENSP00000274192	0.974	3-oxo-5-alpha-steroid 4-dehydrogenase 1
6	9606.ENSP00000355995	0.963	Corticosteroid 11-beta-dehydrogenase isozyme 1
7	9606.ENSP00000318867	0.956	7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
8	9606.ENSP00000264228	0.947	Polyprenol reductase
9	9606.ENSP00000316786	0.938	Corticosteroid 11-beta-dehydrogenase isozyme 2
10	9606.ENSP00000358903	0.938	Steroid 17-alpha-hydroxylase/17,20 lyase
11	9606.ENSP00000358421	0.935	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
12	9606.ENSP00000379683	0.933	Aromatase
13	9606.ENSP00000292427	0.932	Cytochrome P450 11B1, mitochondrial
14	9606.ENSP00000364412	0.931	Testosterone 17-beta-dehydrogenase 3
15	9606.ENSP00000445122	0.931	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
16	9606.ENSP00000451406	0.930	17-beta-hydroxysteroid dehydrogenase type 6
17	9606.ENSP00000199936	0.926	Estradiol 17-beta-dehydrogenase 2
18	9606.ENSP00000325822	0.923	Cytochrome P450 11B2, mitochondrial
19	9606.ENSP00000363794	0.922	Estradiol 17-beta-dehydrogenase 8
20	9606.ENSP00000480443	0.913	Hydroxysteroid 11-beta-dehydrogenase 1-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004033	0.996	aldo-keto reductase (NADP) activity
GO:0005488	0.977	binding
GO:0008106	0.956	alcohol dehydrogenase (NADP+) activity
GO:0016229	0.919	steroid dehydrogenase activity
GO:0005515	0.822	protein binding
GO:0004032	0.440	alditol:NADP+ 1-oxidoreductase activity
GO:0097159	0.322	organic cyclic compound binding
GO:0016627	0.300	oxidoreductase activity, acting on the CH-CH group of donors

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0006629	0.996	lipid metabolic process
GO:0042445	0.991	hormone metabolic process
GO:0009987	0.985	cellular process
GO:0044237	0.982	cellular metabolic process
GO:1901360	0.975	organic cyclic compound metabolic process
GO:0044281	0.961	small molecule metabolic process
GO:0008202	0.961	steroid metabolic process
GO:0009058	0.906	biosynthetic process
GO:0006694	0.895	steroid biosynthetic process
GO:0008209	0.834	androgen metabolic process
GO:0019752	0.463	carboxylic acid metabolic process
GO:1901615	0.437	organic hydroxy compound metabolic process
GO:0032787	0.419	monocarboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0012505	0.462	endomembrane system
GO:0016020	0.345	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	0.999	With NAD(+) or NADP(+) as acceptor.
RHEA:15937	0.956	a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH
EC:1.1.1.2	0.956	alcohol dehydrogenase (NADP(+)).
RHEA:12789	0.440	an alditol + NADP(+) = an aldose + H(+) + NADPH
EC:1.1.1.21	0.440	aldose reductase.
EC:1.3.-.-	0.300	Acting on the CH-CH group of donors.

[back to server]