StarFunc result for job id P51864

User Input

>input (188 residues)
MDCRKMVRFSYSVIWIMAISKAFELGLVAGLGHQEFARPSRGDLAFRDDSIWPQEEPAIR
PRSSQRVLPMGIQHSKELNRTCCLNGGTCMLESFCACPPSFYGRNCEHDVRKENCGSVPH
DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLAGI
CLSIQSYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13385	0.508	0.508	2.779E-30	188	0.968	0.968	P13385.pdb.gz	TDGF1_HUMAN Protein Cripto OS=Homo sapiens OX=9606 GN=CRIPTO PE=1 SV=1
2	AFDB:P51865	0.418	0.453	2.884E-21	171	0.628	0.690	P51865.pdb.gz	TDGF1_MOUSE Teratocarcinoma-derived growth factor OS=Mus musculus OX=10090 GN=Cripto PE=1 SV=2
3	AFDB:P0CG37	0.259	0.227	1.036E-9	223	0.255	0.215	P0CG37.pdb.gz	CFC1_HUMAN Cryptic protein OS=Homo sapiens OX=9606 GN=CFC1 PE=1 SV=1
4	AFDB:P97766	0.223	0.214	1.871E-9	202	0.287	0.267	P97766.pdb.gz	CFC1_MOUSE Cryptic protein OS=Mus musculus OX=10090 GN=Cfc1 PE=1 SV=1
5	AFDB:Q91649	0.286	0.284	3.610E-9	190	0.298	0.295	Q91649.pdb.gz	Q91649_XENLA Fibroblast growth factor receptor ligand 1 OS=Xenopus laevis OX=8355 GN=cripto1.3.L PE=2 SV=1
6	AFDB:F1LV65	0.227	0.250	8.480E-9	164	0.250	0.287	F1LV65.pdb.gz	F1LV65_RAT Cripto, FRL-1, cryptic family 1 OS=Rattus norvegicus OX=10116 GN=Cfc1 PE=3 SV=4
7	AFDB:F1Q691	0.284	0.281	3.843E-8	190	0.287	0.284	F1Q691.pdb.gz	F1Q691_DANRE Cryptic protein isoform 1 precursor OS=Danio rerio OX=7955 GN=cb85 PE=3 SV=1
8	AFDB:Q6R8J2	0.176	0.048	7.272E-2	977	0.122	0.024	Q6R8J2.pdb.gz	HEG_DANRE Protein HEG OS=Danio rerio OX=7955 GN=heg PE=1 SV=1
9	AFDB:A0A0R4IAF3	0.151	0.033	3.086E-1	1254	0.096	0.014	A0A0R4IAF3.pdb.gz
10	PDB:7nycC	0.133	0.035	4.575E-1	809	0.080	0.019	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
11	AFDB:A0A1D8PKY1	0.143	0.048	8.266E-1	800	0.128	0.030	A0A1D8PKY1.pdb.gz	A0A1D8PKY1_CANAL Cnh1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CNH1 PE=3 SV=1
12	PDB:6h03C	0.151	0.058	1.075	513	0.090	0.033	6h03C.pdb.gz
13	PDB:7nycD	0.146	0.059	1.226	487	0.069	0.027	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
14	PDB:4e0sB	0.141	0.033	1.702	898	0.080	0.017	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
15	PDB:3t5oA	0.144	0.033	2.364	871	0.059	0.013	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
16	PDB:5fxtA	0.100	0.052	3.999	374	0.021	0.011	5fxtA.pdb.gz	Screening of E. coli beta-clamp Inhibitors Revealed that Few Inhibit Helicobacter pylori More Effectively: Structural and Functional Characterization.
17	PDB:7wb4c	0.116	0.066	3.999	346	0.021	0.012	7wb4c.pdb.gz
18	PDB:6h03G	0.147	0.061	4.271	501	0.074	0.028	6h03G.pdb.gz
19	PDB:3u9sI	0.108	0.043	5.201	498	0.021	0.008	3u9sI.pdb.gz	An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
20	PDB:3o2gA	0.119	0.062	5.931	386	0.011	0.005	3o2gA.pdb.gz	Structural and mechanistic studies on gamma-butyrobetaine hydroxylase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51864	2.33e-141	393	188	1.000	1.000	TDGF3_HUMAN Putative protein CRIPTO3 OS=Homo sapiens OX=9606 GN=CRIPTO3 PE=5 SV=1
2	P13385	6.31e-136	379	188	0.968	0.968	TDGF1_HUMAN Protein Cripto OS=Homo sapiens OX=9606 GN=CRIPTO PE=1 SV=1
3	P51865	1.97e-80	238	171	0.644	0.708	TDGF1_MOUSE Teratocarcinoma-derived growth factor OS=Mus musculus OX=10090 GN=Cripto PE=1 SV=2
4	F1Q691	7.87e-27	102	190	0.250	0.247	F1Q691_DANRE Cryptic protein isoform 1 precursor OS=Danio rerio OX=7955 GN=cb85 PE=3 SV=1
5	A7MCB2	1.12e-26	102	183	0.245	0.251	A7MCB2_DANRE Cryptic protein isoform 2 precursor OS=Danio rerio OX=7955 GN=oep PE=2 SV=1
6	Q91649	6.78e-24	95.1	190	0.271	0.268	Q91649_XENLA Fibroblast growth factor receptor ligand 1 OS=Xenopus laevis OX=8355 GN=cripto1.3.L PE=2 SV=1
7	P97766	7.45e-18	79.3	202	0.181	0.168	CFC1_MOUSE Cryptic protein OS=Mus musculus OX=10090 GN=Cfc1 PE=1 SV=1
8	P0CG37	1.62e-17	79.0	223	0.186	0.157	CFC1_HUMAN Cryptic protein OS=Homo sapiens OX=9606 GN=CFC1 PE=1 SV=1
9	F1LV65	1.64e-17	77.8	170	0.181	0.200	F1LV65_RAT Cripto, FRL-1, cryptic family 1 OS=Rattus norvegicus OX=10116 GN=Cfc1 PE=3 SV=4
10	A0A8I6GC89	1.76e-17	78.6	201	0.181	0.169	A0A8I6GC89_RAT Cripto, FRL-1, cryptic family 1 OS=Rattus norvegicus OX=10116 GN=Cfc1 PE=3 SV=1
11	O88277	1.01e-05	47.4	4351	0.122	0.005	FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus OX=10116 GN=Fat2 PE=1 SV=1
12	Q9NYQ8	4.09e-05	45.8	4349	0.133	0.006	FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens OX=9606 GN=FAT2 PE=1 SV=2
13	Q9Y5W5	7.67e-04	41.6	379	0.096	0.047	WIF1_HUMAN Wnt inhibitory factor 1 OS=Homo sapiens OX=9606 GN=WIF1 PE=1 SV=3
14	Q9WUA1	8.50e-04	41.6	379	0.096	0.047	WIF1_MOUSE Wnt inhibitory factor 1 OS=Mus musculus OX=10090 GN=Wif1 PE=2 SV=1
15	A0MZ89	0.003	37.0	58	0.117	0.379	A0MZ89_PIG NOTCH1 (Fragment) OS=Sus scrofa OX=9823 PE=2 SV=1
16	Q2PZL6	0.003	40.0	4981	0.122	0.005	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
17	P46531	0.006	39.3	2555	0.170	0.013	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
18	Q95RQ1	0.007	38.9	512	0.085	0.031	Q95RQ1_DROME LD16414p OS=Drosophila melanogaster OX=7227 GN=slow PE=2 SV=1
19	Q9W6F9	0.011	38.1	378	0.090	0.045	WIF1_DANRE Wnt inhibitory factor 1 OS=Danio rerio OX=7955 GN=wif1 PE=2 SV=1
20	Q6V0I7	0.015	38.1	4981	0.112	0.004	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09443 CFC	2e-13	61.3	Cripto_Frl-1_Cryptic (CFC)
2	PF00008 EGF	26	16.6	EGF-like domain
3	PF07974 EGF_2	43	15.9	EGF-like domain
4	PF12661 hEGF	2.6e+02	13.7	Human growth factor-like EGF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000003391

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000006266	0.896	Receptor protein serine/threonine kinase
2	9593.ENSGGOP00000001458	0.889	Glypican 1
3	9593.ENSGGOP00000004612	0.877	Mothers against decapentaplegic homolog
4	9593.ENSGGOP00000022447	0.818	POU domain protein
5	9593.ENSGGOP00000015331	0.815	Serine/threonine-protein kinase receptor
6	9593.ENSGGOP00000022071	0.806	Receptor protein serine/threonine kinase
7	9593.ENSGGOP00000001802	0.804	Serine/threonine-protein kinase receptor
8	9593.ENSGGOP00000002542	0.804	Nodal growth differentiation factor
9	9593.ENSGGOP00000003945	0.780	Required for meiotic nuclear division 5 homolog A (S. cerevisiae)
10	9593.ENSGGOP00000024325	0.750	SRY-box 1
11	9593.ENSGGOP00000000851	0.715	Left-right determination factor 2
12	9593.ENSGGOP00000022094	0.703	Uncharacterized protein
13	9593.ENSGGOP00000007283	0.696	Tyrosine-protein kinase
14	9593.ENSGGOP00000007465	0.696	Receptor protein-tyrosine kinase
15	9593.ENSGGOP00000013895	0.694	Left-right determination factor 1
16	9593.ENSGGOP00000004784	0.693	Neuralized E3 ubiquitin protein ligase 1B
17	9593.ENSGGOP00000023543	0.693	Neuralized E3 ubiquitin protein ligase 1
18	9593.ENSGGOP00000023789	0.690	Pro-epidermal growth factor
19	9593.ENSGGOP00000015870	0.688	Forkhead box H1
20	9593.ENSGGOP00000017817	0.688	Heat shock protein family A (Hsp70) member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	0.995	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.996	response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0023052	0.990	signaling
GO:0007154	0.990	cell communication
GO:0048856	0.983	anatomical structure development
GO:0051716	0.978	cellular response to stimulus
GO:0048518	0.977	positive regulation of biological process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0007165	0.958	signal transduction
GO:0032501	0.955	multicellular organismal process
GO:0007275	0.951	multicellular organism development
GO:0048583	0.920	regulation of response to stimulus
GO:0009893	0.909	positive regulation of metabolic process
GO:0010604	0.902	positive regulation of macromolecule metabolic process
GO:0048522	0.887	positive regulation of cellular process
GO:0048731	0.879	system development
GO:0048519	0.858	negative regulation of biological process
GO:0080090	0.855	regulation of primary metabolic process
GO:0051171	0.852	regulation of nitrogen compound metabolic process
GO:0048513	0.843	animal organ development
GO:0031323	0.831	regulation of cellular metabolic process
GO:0009653	0.822	anatomical structure morphogenesis
GO:0023051	0.814	regulation of signaling
GO:0010646	0.813	regulation of cell communication
GO:0051173	0.808	positive regulation of nitrogen compound metabolic process
GO:0009966	0.790	regulation of signal transduction
GO:0031325	0.774	positive regulation of cellular metabolic process
GO:0048523	0.756	negative regulation of cellular process
GO:0030154	0.719	cell differentiation
GO:0010468	0.684	regulation of gene expression
GO:0042127	0.665	regulation of cell population proliferation
GO:0007166	0.601	cell surface receptor signaling pathway
GO:0009889	0.591	regulation of biosynthetic process
GO:0010556	0.584	regulation of macromolecule biosynthetic process
GO:0019219	0.582	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.580	regulation of cellular biosynthetic process
GO:0040012	0.577	regulation of locomotion
GO:0051252	0.567	regulation of RNA metabolic process
GO:0006355	0.555	regulation of DNA-templated transcription
GO:0070848	0.539	response to growth factor
GO:0007167	0.537	enzyme-linked receptor protein signaling pathway
GO:0071704	0.525	organic substance metabolic process
GO:0044237	0.524	cellular metabolic process
GO:0044238	0.494	primary metabolic process
GO:0071363	0.492	cellular response to growth factor stimulus
GO:0008284	0.473	positive regulation of cell population proliferation
GO:0006807	0.462	nitrogen compound metabolic process
GO:0048584	0.442	positive regulation of response to stimulus
GO:0051239	0.441	regulation of multicellular organismal process
GO:0043170	0.437	macromolecule metabolic process
GO:0065009	0.431	regulation of molecular function
GO:0023056	0.431	positive regulation of signaling
GO:0010647	0.431	positive regulation of cell communication
GO:0009967	0.423	positive regulation of signal transduction
GO:0042325	0.417	regulation of phosphorylation
GO:1902533	0.412	positive regulation of intracellular signal transduction
GO:0051247	0.410	positive regulation of protein metabolic process
GO:0030334	0.408	regulation of cell migration
GO:0044093	0.395	positive regulation of molecular function
GO:0007178	0.387	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0050790	0.358	regulation of catalytic activity
GO:0009888	0.334	tissue development
GO:0045935	0.333	positive regulation of nucleobase-containing compound metabolic process
GO:0050793	0.330	regulation of developmental process
GO:0006357	0.327	regulation of transcription by RNA polymerase II
GO:0031328	0.325	positive regulation of cellular biosynthetic process
GO:0010557	0.324	positive regulation of macromolecule biosynthetic process
GO:0036211	0.315	protein modification process
GO:0051254	0.311	positive regulation of RNA metabolic process
GO:1902680	0.301	positive regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.911	extracellular region
GO:0005615	0.798	extracellular space
GO:0005622	0.765	intracellular anatomical structure
GO:0009986	0.748	cell surface
GO:0043231	0.715	intracellular membrane-bounded organelle
GO:0005737	0.635	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]