StarFunc result for job id P51878

User Input

>input (434 residues)
MAEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVK
KDNHKKKTVKMLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIEDKALILVDSLR
KNRVAHQMFTQTLLNMDQKITSVKPLLQIEAGPPESAESTNILKLCPREEFLRLCKKNHD
EIYPIKKREDRRRLALIICNTKFDHLPARNGAHYDIVGMKRLLQGLGYTVVDEKNLTARD
MESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKKKKPDVLLYDTIFQIFNNRNC
LSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFIAF
CSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIE
RATLTRDFYLFPGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51878	1.000	1.000	2.311E-86	434	1.000	1.000	P51878.pdb.gz	CASP5_HUMAN Caspase-5 OS=Homo sapiens OX=9606 GN=CASP5 PE=1 SV=3
2	AFDB:P49662	0.631	0.724	1.466E-59	377	0.636	0.732	P49662.pdb.gz	CASP4_HUMAN Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
3	AFDB:O75601	0.633	0.726	2.942E-57	377	0.583	0.671	O75601.pdb.gz	CASPD_BOVIN Caspase-13 OS=Bos taurus OX=9913 GN=CASP13 PE=1 SV=1
4	AFDB:P70343	0.632	0.729	5.751E-48	373	0.461	0.536	P70343.pdb.gz	CASP4_MOUSE Caspase-4 OS=Mus musculus OX=10090 GN=Casp4 PE=1 SV=2
5	AFDB:E9PSM0	0.608	0.736	3.232E-47	356	0.435	0.531	E9PSM0.pdb.gz	E9PSM0_RAT Caspase 4 OS=Rattus norvegicus OX=10116 GN=Casp4 PE=3 SV=4
6	AFDB:Q920D5	0.627	0.647	4.048E-46	420	0.435	0.450	Q920D5.pdb.gz	CASPC_RAT Caspase-12 OS=Rattus norvegicus OX=10116 GN=Casp12 PE=1 SV=1
7	AFDB:O08736	0.619	0.640	8.832E-45	419	0.438	0.453	O08736.pdb.gz	CASPC_MOUSE Caspase-12 OS=Mus musculus OX=10090 GN=Casp12 PE=1 SV=1
8	AFDB:P43527	0.642	0.689	1.969E-44	402	0.415	0.448	P43527.pdb.gz	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
9	AFDB:P29466	0.565	0.607	3.031E-44	404	0.422	0.453	P29466.pdb.gz	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
10	AFDB:P29452	0.618	0.662	8.999E-43	402	0.408	0.440	P29452.pdb.gz	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
11	PDB:4pryA	0.478	0.817	1.696E-19	249	0.164	0.285	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
12	PDB:4fdlB	0.473	0.849	4.548E-19	239	0.138	0.251	4fdlB.pdb.gz
13	PDB:4nblA	0.457	0.755	2.352E-17	258	0.159	0.267	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
14	PDB:2wdpD	0.407	0.737	5.561E-14	230	0.157	0.296	2wdpD.pdb.gz
15	PDB:4iyrB	0.388	0.853	1.402E-13	191	0.131	0.298	4iyrB.pdb.gz
16	PDB:7wzsB	0.411	0.840	6.549E-13	206	0.118	0.248	7wzsB.pdb.gz
17	PDB:4af8A	0.330	0.411	9.817E-6	333	0.118	0.153	4af8A.pdb.gz
18	PDB:4ptyD	0.172	0.348	1.540E-3	175	0.044	0.109	4ptyD.pdb.gz	Crystal Structure of Escherichia coli SsuE: Defining a General Catalytic Cycle for FMN Reductases of the Flavodoxin-like Superfamily.
19	PDB:5wbjA	0.242	0.112	1.638E-3	1058	0.067	0.027	5wbjA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
20	PDB:6w8rA	0.339	0.397	2.682E-3	364	0.078	0.093	6w8rA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75601	0.0	514	377	0.590	0.679	CASPD_BOVIN Caspase-13 OS=Bos taurus OX=9913 GN=CASP13 PE=1 SV=1
2	P49662	0.0	575	377	0.636	0.732	CASP4_HUMAN Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
3	P51878	0.0	904	434	1.000	1.000	CASP5_HUMAN Caspase-5 OS=Homo sapiens OX=9606 GN=CASP5 PE=1 SV=3
4	Q3MHS1	1.05e-136	399	373	0.468	0.544	Q3MHS1_RAT Caspase 4, apoptosis-related cysteine peptidase OS=Rattus norvegicus OX=10116 GN=Casp4 PE=2 SV=1
5	E9PSM0	3.52e-136	398	400	0.468	0.507	E9PSM0_RAT Caspase 4 OS=Rattus norvegicus OX=10116 GN=Casp4 PE=3 SV=4
6	P70343	1.17e-135	396	373	0.465	0.542	CASP4_MOUSE Caspase-4 OS=Mus musculus OX=10090 GN=Casp4 PE=1 SV=2
7	P29466	1.14e-115	346	404	0.442	0.475	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
8	O08736	7.00e-114	342	419	0.438	0.453	CASPC_MOUSE Caspase-12 OS=Mus musculus OX=10090 GN=Casp12 PE=1 SV=1
9	Q920D5	1.88e-113	341	420	0.438	0.452	CASPC_RAT Caspase-12 OS=Rattus norvegicus OX=10116 GN=Casp12 PE=1 SV=1
10	P43527	8.86e-102	310	402	0.410	0.443	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
11	P29452	7.80e-101	308	402	0.415	0.448	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
12	Q6UXS9	3.02e-95	291	341	0.332	0.422	CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens OX=9606 GN=CASP12 PE=2 SV=3
13	O42284	4.96e-68	219	283	0.286	0.438	O42284_CHICK Caspase-1 OS=Gallus gallus OX=9031 PE=2 SV=1
14	Q9I9L7	5.49e-56	191	383	0.244	0.277	CASPA_DANRE Caspase a OS=Danio rerio OX=7955 GN=caspa PE=1 SV=1
15	A0A060XPX2	1.47e-55	189	353	0.279	0.343	A0A060XPX2_ONCMY Caspase-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039688001 PE=3 SV=1
16	E9PMT1	2.28e-51	172	147	0.198	0.585	E9PMT1_HUMAN Caspase 4 (Fragment) OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
17	Q504J1	1.23e-43	159	404	0.230	0.248	CASPB_DANRE Caspase b OS=Danio rerio OX=7955 GN=caspb PE=1 SV=1
18	W0TYK3	2.32e-36	134	213	0.159	0.324	W0TYK3_ONCMY Caspase 1b (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=casp1b PE=2 SV=1
19	Q9IB67	1.01e-27	116	423	0.189	0.194	Q9IB67_XENLA Caspase 2 L homeolog OS=Xenopus laevis OX=8355 GN=casp2.L PE=1 SV=1
20	D3YT61	2.97e-24	103	287	0.184	0.279	D3YT61_CAEEL Cell death protein 3 subunit p17 OS=Caenorhabditis elegans OX=6239 GN=ced-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	4.8e-11	53.8	Caspase recruitment domain
2	PF07063 DUF1338	1.1e+02	13.4	Domain of unknown function (DUF1338)
3	PF00656 Peptidase_C14	2.3e-43	160.1	Caspase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376849

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478516	0.998	NACHT, LRR and PYD domains-containing protein 1
2	9606.ENSP00000247470	0.996	Apoptosis-associated speck-like protein containing a CARD
3	9606.ENSP00000337383	0.985	NACHT, LRR and PYD domains-containing protein 3
4	9606.ENSP00000375767	0.979	Caspase recruitment domain-containing protein 8
5	9606.ENSP00000357112	0.975	Interferon-inducible protein AIM2
6	9606.ENSP00000433209	0.966	Gasdermin-D
7	9606.ENSP00000385090	0.943	NLR family CARD domain-containing protein 4
8	9606.ENSP00000433138	0.937	Caspase-1
9	9606.ENSP00000331857	0.927	NACHT, LRR and PYD domains-containing protein 9
10	9606.ENSP00000225296	0.903	Putative ATP-dependent RNA helicase DHX33
11	9606.ENSP00000293831	0.901	Eukaryotic initiation factor 4A-I
12	9606.ENSP00000383274	0.901	Eukaryotic translation initiation factor 4 gamma 3
13	9606.ENSP00000416255	0.901	Eukaryotic translation initiation factor 4 gamma 1
14	9606.ENSP00000433664	0.901	Eukaryotic translation initiation factor 4 gamma 2
15	9606.ENSP00000349428	0.900	Polypyrimidine tract-binding protein 1
16	9606.ENSP00000358140	0.900	Eukaryotic translation initiation factor 3 subunit A
17	9606.ENSP00000359216	0.900	Polypyrimidine tract-binding protein 2
18	9606.ENSP00000425561	0.900	Eukaryotic translation initiation factor 4E
19	9606.ENSP00000388566	0.894	Caspase-4
20	9606.ENSP00000428657	0.822	Baculoviral IAP repeat-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004197	1.000	cysteine-type endopeptidase activity
GO:0019904	0.845	protein domain specific binding
GO:0019899	0.825	enzyme binding
GO:0042802	0.674	identical protein binding
GO:0098772	0.490	molecular function regulator activity
GO:0140677	0.382	molecular function activator activity
GO:0002020	0.324	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.994	response to stimulus
GO:0012501	0.993	programmed cell death
GO:0051716	0.983	cellular response to stimulus
GO:0065007	0.967	biological regulation
GO:0050789	0.964	regulation of biological process
GO:0048518	0.947	positive regulation of biological process
GO:0071704	0.932	organic substance metabolic process
GO:0044238	0.918	primary metabolic process
GO:0009605	0.916	response to external stimulus
GO:0050794	0.916	regulation of cellular process
GO:0006915	0.911	apoptotic process
GO:0006807	0.889	nitrogen compound metabolic process
GO:0043170	0.875	macromolecule metabolic process
GO:1901564	0.853	organonitrogen compound metabolic process
GO:0032501	0.842	multicellular organismal process
GO:0019222	0.837	regulation of metabolic process
GO:0019538	0.834	protein metabolic process
GO:0032502	0.804	developmental process
GO:0006508	0.801	proteolysis
GO:0060255	0.799	regulation of macromolecule metabolic process
GO:0006950	0.707	response to stress
GO:0048522	0.685	positive regulation of cellular process
GO:0048856	0.679	anatomical structure development
GO:0048583	0.632	regulation of response to stimulus
GO:0009628	0.601	response to abiotic stimulus
GO:0080090	0.570	regulation of primary metabolic process
GO:0051171	0.569	regulation of nitrogen compound metabolic process
GO:0007275	0.561	multicellular organism development
GO:0010604	0.519	positive regulation of macromolecule metabolic process
GO:0007154	0.507	cell communication
GO:0010468	0.485	regulation of gene expression
GO:0023052	0.444	signaling
GO:0048584	0.440	positive regulation of response to stimulus
GO:0007165	0.427	signal transduction
GO:0051246	0.426	regulation of protein metabolic process
GO:0042221	0.423	response to chemical
GO:0048731	0.413	system development
GO:0009966	0.411	regulation of signal transduction
GO:0010033	0.396	response to organic substance
GO:0048513	0.395	animal organ development
GO:0050790	0.394	regulation of catalytic activity
GO:0071310	0.388	cellular response to organic substance
GO:0048857	0.379	neural nucleus development
GO:0044093	0.373	positive regulation of molecular function
GO:0009607	0.372	response to biotic stimulus
GO:0044419	0.370	biological process involved in interspecies interaction between organisms
GO:0030901	0.370	midbrain development
GO:0051173	0.368	positive regulation of nitrogen compound metabolic process
GO:0052547	0.368	regulation of peptidase activity
GO:0001817	0.363	regulation of cytokine production
GO:0051707	0.362	response to other organism
GO:0051247	0.362	positive regulation of protein metabolic process
GO:0006952	0.356	defense response
GO:0010941	0.342	regulation of cell death
GO:0080134	0.332	regulation of response to stress
GO:0001819	0.321	positive regulation of cytokine production
GO:0043067	0.320	regulation of programmed cell death
GO:0002376	0.315	immune system process
GO:0023056	0.315	positive regulation of signaling
GO:0010647	0.315	positive regulation of cell communication
GO:0104004	0.302	cellular response to environmental stimulus
GO:0009967	0.300	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0043226	0.926	organelle
GO:0043227	0.920	membrane-bounded organelle
GO:0043229	0.918	intracellular organelle
GO:0043231	0.901	intracellular membrane-bounded organelle
GO:0016020	0.848	membrane
GO:0061702	0.771	inflammasome complex
GO:0071944	0.681	cell periphery
GO:0012505	0.585	endomembrane system
GO:0005886	0.398	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.

[back to server]