StarFunc result for job id P51911

User Input

>input (297 residues)
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
CEFINKLQPGSVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51911	1.000	1.000	7.218E-43	297	1.000	1.000	P51911.pdb.gz	CNN1_HUMAN Calponin-1 OS=Homo sapiens OX=9606 GN=CNN1 PE=1 SV=2
2	AFDB:P26932	0.574	0.582	8.301E-35	292	0.825	0.839	P26932.pdb.gz	CNN1_CHICK Calponin-1 OS=Gallus gallus OX=9031 GN=CNN1 PE=1 SV=2
3	AFDB:P37397	0.662	0.601	3.149E-30	330	0.673	0.606	P37397.pdb.gz	CNN3_RAT Calponin-3 OS=Rattus norvegicus OX=10116 GN=Cnn3 PE=1 SV=1
4	AFDB:Q4F876	0.548	0.531	1.535E-28	307	0.657	0.635	Q4F876.pdb.gz
5	AFDB:Q99439	0.541	0.520	1.302E-27	309	0.616	0.592	Q99439.pdb.gz	CNN2_HUMAN Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4
6	AFDB:P37802	0.533	0.768	3.429E-14	199	0.283	0.422	P37802.pdb.gz	TAGL2_HUMAN Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3
7	AFDB:A0A2R8QQS8	0.526	0.701	7.460E-14	216	0.286	0.394	A0A2R8QQS8.pdb.gz
8	AFDB:Q9R1Q8	0.514	0.734	7.831E-14	199	0.283	0.422	Q9R1Q8.pdb.gz	TAGL3_MOUSE Transgelin-3 OS=Mus musculus OX=10090 GN=Tagln3 PE=1 SV=1
9	AFDB:P31232	0.509	0.720	1.155E-13	201	0.263	0.388	P31232.pdb.gz	TAGL_RAT Transgelin OS=Rattus norvegicus OX=10116 GN=Tagln PE=1 SV=2
10	AFDB:Q9VZI1	0.523	0.787	2.132E-12	188	0.256	0.404	Q9VZI1.pdb.gz	Q9VZI1_DROME Transgelin OS=Drosophila melanogaster OX=7227 GN=Chd64 PE=1 SV=2
11	PDB:7sj9M	0.291	0.586	2.616E-2	131	0.074	0.168	7sj9M.pdb.gz	Structural transitions in the GTP cap visualized by cryo-electron microscopy of catalytically inactive microtubules.
12	PDB:2r8uB	0.265	0.508	5.423E-2	136	0.081	0.176	2r8uB.pdb.gz	Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal domain at 1.35 A resolution
13	PDB:7sx8D	0.298	0.204	1.658E-1	448	0.061	0.040	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
14	PDB:1sjjA	0.289	0.104	1.976	863	0.054	0.019	1sjjA.pdb.gz
15	PDB:2mxxA	0.121	0.166	2.400	179	0.094	0.156	2mxxA.pdb.gz
16	PDB:1gu6A	0.115	0.086	2.644	441	0.064	0.043	1gu6A.pdb.gz	Structure and Spectroscopy of the Periplasmic Cytochrome C Nitrite Reductase from Escherichia Coli
17	PDB:2q7nB	0.118	0.162	2.644	180	0.081	0.133	2q7nB.pdb.gz
18	PDB:1gncA	0.125	0.175	2.776	175	0.061	0.103	1gncA.pdb.gz
19	PDB:7sqcC2	0.275	0.062	3.059	1498	0.091	0.018	7sqcC2.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:1a7mA	0.116	0.167	3.212	180	0.088	0.144	1a7mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26932	0.0	508	292	0.825	0.839	CNN1_CHICK Calponin-1 OS=Gallus gallus OX=9031 GN=CNN1 PE=1 SV=2
2	P51911	0.0	624	297	1.000	1.000	CNN1_HUMAN Calponin-1 OS=Homo sapiens OX=9606 GN=CNN1 PE=1 SV=2
3	Q08290	0.0	612	297	0.976	0.976	CNN1_RAT Calponin-1 OS=Rattus norvegicus OX=10116 GN=Cnn1 PE=1 SV=1
4	Q9GK38	0.0	617	297	0.987	0.987	CNN1_MUSPF Calponin-1 OS=Mustela putorius furo OX=9669 GN=CNN1 PE=1 SV=1
5	Q15417	3.50e-149	423	329	0.677	0.611	CNN3_HUMAN Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3 PE=1 SV=1
6	P37397	2.11e-148	421	330	0.673	0.606	CNN3_RAT Calponin-3 OS=Rattus norvegicus OX=10116 GN=Cnn3 PE=1 SV=1
7	Q6PBA5	1.34e-137	392	307	0.640	0.619	Q6PBA5_DANRE Calponin OS=Danio rerio OX=7955 GN=wu:fb93a05 PE=1 SV=1
8	Q08093	1.35e-130	375	305	0.609	0.593	CNN2_MOUSE Calponin-2 OS=Mus musculus OX=10090 GN=Cnn2 PE=1 SV=1
9	Q99439	1.24e-129	372	309	0.609	0.586	CNN2_HUMAN Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4
10	P37802	3.39e-44	151	199	0.283	0.422	TAGL2_HUMAN Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3
11	Q9UI15	1.78e-42	146	199	0.283	0.422	TAGL3_HUMAN Transgelin-3 OS=Homo sapiens OX=9606 GN=TAGLN3 PE=1 SV=2
12	Q9R1Q8	2.71e-42	146	199	0.283	0.422	TAGL3_MOUSE Transgelin-3 OS=Mus musculus OX=10090 GN=Tagln3 PE=1 SV=1
13	Q6TGT5	1.98e-41	144	201	0.279	0.413	Q6TGT5_DANRE Transgelin OS=Danio rerio OX=7955 GN=TAGLN PE=1 SV=1
14	Q01995	3.46e-40	140	201	0.263	0.388	TAGL_HUMAN Transgelin OS=Homo sapiens OX=9606 GN=TAGLN PE=1 SV=4
15	P31232	5.43e-40	140	201	0.259	0.383	TAGL_RAT Transgelin OS=Rattus norvegicus OX=10116 GN=Tagln PE=1 SV=2
16	Q9VZI1	2.82e-38	135	188	0.256	0.404	Q9VZI1_DROME Transgelin OS=Drosophila melanogaster OX=7227 GN=Chd64 PE=1 SV=2
17	M9PE30	1.16e-34	125	175	0.239	0.406	M9PE30_DROME Transgelin OS=Drosophila melanogaster OX=7227 GN=Chd64 PE=1 SV=1
18	Q1HQ70	1.88e-31	117	188	0.236	0.372	Q1HQ70_BOMMO Transgelin OS=Bombyx mori OX=7091 GN=732906 PE=1 SV=1
19	P14318	7.24e-30	113	184	0.226	0.364	MP20_DROME Muscle-specific protein 20 OS=Drosophila melanogaster OX=7227 GN=Mp20 PE=2 SV=2
20	P37806	7.78e-17	82.8	565	0.195	0.103	UNC87_CAEEL Protein unc-87 OS=Caenorhabditis elegans OX=6239 GN=unc-87 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03494 Beta-APP	9.2e+02	11.1	Beta-amyloid peptide (beta-APP)
2	PF00402 Calponin	6.6e-40	145.6	Calponin family repeat
3	PF11971 CAMSAP_CH	44	15.3	CAMSAP CH domain
4	PF06395 CDC24	4e+02	12.7	CDC24 Calponin
5	PF00307 CH	9.7e-21	85.4	Calponin homology (CH) domain
6	PF18579 Raf1_HTH	3.7e+02	12.2	Rubisco accumulation factor 1 helix turn helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003830553.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003810405.1	0.922	Actin, gamma 2, smooth muscle, enteric
2	9597.XP_008963702.1	0.792	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
3	9597.XP_003830496.1	0.756	Growth arrest-specific protein 2
4	9597.XP_008950535.1	0.751	Smoothelin
5	9597.XP_008962169.1	0.736	Utrophin isoform X1
6	9597.XP_003810561.1	0.723	Actin, alpha 2, smooth muscle, aorta
7	9597.XP_003812182.1	0.723	Actin, alpha cardiac muscle 1
8	9597.XP_003830532.1	0.705	SPC24, NDC80 kinetochore complex component
9	9597.XP_008971763.1	0.703	Belongs to the calponin family.
10	9597.XP_003830964.1	0.694	Pleckstrin
11	9597.XP_003824507.1	0.660	Actin, alpha 1, skeletal muscle
12	9597.XP_008952493.1	0.660	Actin, alpha skeletal muscle 2-like
13	9597.XP_003832013.1	0.642	Belongs to the actin family.
14	9597.XP_003830929.1	0.639	EH domain-binding protein 1 isoform X1
15	9597.XP_003829433.1	0.627	Myocardin
16	9597.XP_003832506.1	0.619	acyl-CoA dehydrogenase family member 10 isoform X1
17	9597.XP_003821360.1	0.591	Sperm flagellar 1
18	9597.XP_008971155.1	0.588	Plectin
19	9597.XP_008951792.1	0.587	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 100 ESTs, 2 Proteins, and 71% coverage of the annotated genomic feature by RNAseq alignments
20	9597.XP_003805286.2	0.583	Drebrin-like protein isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.842	cytoskeletal protein binding
GO:0003779	0.367	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.909	cellular process
GO:0051239	0.693	regulation of multicellular organismal process
GO:0048660	0.548	regulation of smooth muscle cell proliferation
GO:0048519	0.525	negative regulation of biological process
GO:0032502	0.503	developmental process
GO:0048523	0.488	negative regulation of cellular process
GO:0048856	0.480	anatomical structure development
GO:0050896	0.471	response to stimulus
GO:0044057	0.403	regulation of system process
GO:0016043	0.388	cellular component organization
GO:0048518	0.383	positive regulation of biological process
GO:0090257	0.347	regulation of muscle system process
GO:0048522	0.336	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.998	cytoskeleton
GO:0030054	0.997	cell junction
GO:0070161	0.985	anchoring junction
GO:0005737	0.984	cytoplasm
GO:0005925	0.970	focal adhesion
GO:0043227	0.956	membrane-bounded organelle
GO:0005829	0.951	cytosol
GO:0043231	0.887	intracellular membrane-bounded organelle
GO:0015629	0.767	actin cytoskeleton
GO:0005576	0.693	extracellular region
GO:0031982	0.691	vesicle
GO:0005634	0.674	nucleus
GO:0099512	0.659	supramolecular fiber
GO:0005615	0.569	extracellular space
GO:0065010	0.565	extracellular membrane-bounded organelle
GO:0071944	0.406	cell periphery
GO:0016020	0.356	membrane
GO:0031981	0.314	nuclear lumen
GO:0099513	0.312	polymeric cytoskeletal fiber
GO:0070062	0.309	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]