StarFunc result for job id P51946

User Input

>input (323 residues)
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPI
LENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVESL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C9K506	0.986	0.986	8.303E-40	323	0.969	0.969	C9K506.pdb.gz
2	PDB:7egb9	0.863	0.969	9.098E-32	287	0.889	1.000	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
3	AFDB:O17144	0.849	0.844	8.525E-22	325	0.424	0.422	O17144.pdb.gz	O17144_DROME Cyclin-H (Fragment) OS=Drosophila melanogaster OX=7227 GN=CycH PE=2 SV=1
4	AFDB:Q8W5S1	0.767	0.738	1.683E-14	336	0.297	0.286	Q8W5S1.pdb.gz	CCH11_ARATH Cyclin-H1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCH1-1 PE=1 SV=1
5	AFDB:P36613	0.727	0.729	9.220E-13	322	0.285	0.286	P36613.pdb.gz	CGM2_SCHPO Cyclin mcs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcs2 PE=1 SV=1
6	AFDB:P37366	0.708	0.588	1.097E-12	393	0.269	0.221	P37366.pdb.gz	CCL1_YEAST Cyclin CCL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCL1 PE=1 SV=1
7	PDB:7kueB	0.580	0.814	1.227E-10	225	0.217	0.311	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
8	AFDB:P25008	0.600	0.712	1.642E-9	267	0.201	0.243	P25008.pdb.gz	CCNC_DROME Cyclin-C OS=Drosophila melanogaster OX=7227 GN=CycC PE=1 SV=1
9	AFDB:F1RBC9	0.655	0.740	2.651E-9	283	0.214	0.244	F1RBC9.pdb.gz
10	AFDB:Q86KE7	0.613	0.761	4.667E-9	255	0.189	0.239	Q86KE7.pdb.gz	CCNC_DICDI Cyclin-C OS=Dictyostelium discoideum OX=44689 GN=cycC PE=3 SV=1
11	AFDB:O74627	0.561	0.534	1.649E-8	342	0.189	0.178	O74627.pdb.gz	CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pch1 PE=1 SV=1
12	AFDB:Q8IKK0	0.722	0.716	2.548E-8	326	0.173	0.172	Q8IKK0.pdb.gz	Q8IKK0_PLAF7 Cyclin 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1463700 PE=3 SV=1
13	PDB:5hbhB	0.617	0.727	2.591E-8	270	0.217	0.259	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
14	PDB:7kpvB	0.630	0.694	2.838E-7	290	0.186	0.207	7kpvB.pdb.gz
15	PDB:6gzhB	0.582	0.727	6.802E-6	252	0.139	0.179	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
16	PDB:2w96A	0.444	0.559	7.421E-6	249	0.158	0.205	2w96A.pdb.gz
17	PDB:3g33B	0.448	0.605	1.555E-5	229	0.121	0.170	3g33B.pdb.gz
18	PDB:1zp2A	0.433	0.597	2.203E-5	227	0.155	0.220	1zp2A.pdb.gz
19	PDB:7jv7B	0.486	0.504	2.749E-4	310	0.136	0.142	7jv7B.pdb.gz
20	PDB:7nj0C	0.458	0.537	5.055E-4	270	0.127	0.152	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51946	0.0	669	323	1.000	1.000	CCNH_HUMAN Cyclin-H OS=Homo sapiens OX=9606 GN=CCNH PE=1 SV=1
2	Q61458	0.0	646	323	0.950	0.950	CCNH_MOUSE Cyclin-H OS=Mus musculus OX=10090 GN=Ccnh PE=1 SV=2
3	O76513	1.27e-81	252	324	0.418	0.417	O76513_DROME Cyclin-H OS=Drosophila melanogaster OX=7227 GN=CycH PE=1 SV=1
4	O17144	1.15e-80	249	325	0.415	0.412	O17144_DROME Cyclin-H (Fragment) OS=Drosophila melanogaster OX=7227 GN=CycH PE=2 SV=1
5	Q8W5S1	5.78e-39	142	336	0.328	0.315	CCH11_ARATH Cyclin-H1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCH1-1 PE=1 SV=1
6	P36613	2.56e-29	116	322	0.260	0.261	CGM2_SCHPO Cyclin mcs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcs2 PE=1 SV=1
7	P37366	4.03e-27	111	393	0.291	0.239	CCL1_YEAST Cyclin CCL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCL1 PE=1 SV=1
8	Q86KE7	2.19e-15	76.6	255	0.183	0.231	CCNC_DICDI Cyclin-C OS=Dictyostelium discoideum OX=44689 GN=cycC PE=3 SV=1
9	P25008	5.07e-13	70.1	267	0.164	0.199	CCNC_DROME Cyclin-C OS=Drosophila melanogaster OX=7227 GN=CycC PE=1 SV=1
10	P39947	2.39e-12	68.6	278	0.152	0.176	CCNC_RAT Cyclin-C OS=Rattus norvegicus OX=10116 GN=Ccnc PE=2 SV=2
11	Q62447	3.85e-12	67.8	283	0.152	0.173	CCNC_MOUSE Cyclin-C OS=Mus musculus OX=10090 GN=Ccnc PE=2 SV=4
12	Q6STL0	4.16e-12	67.8	283	0.152	0.173	Q6STL0_DANRE Cyclin-C OS=Danio rerio OX=7955 GN=CCNC PE=2 SV=1
13	P24863	7.13e-12	67.0	283	0.152	0.173	CCNC_HUMAN Cyclin-C OS=Homo sapiens OX=9606 GN=CCNC PE=1 SV=2
14	P47821	1.34e-10	63.5	323	0.189	0.189	SSN8_YEAST RNA polymerase II holoenzyme cyclin-like subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSN8 PE=1 SV=1
15	F4KD43	4.04e-08	57.0	590	0.164	0.090	F4KD43_ARATH Cyclin family protein OS=Arabidopsis thaliana OX=3702 GN=CYCT1:5 PE=1 SV=1
16	Q8GYM6	4.39e-08	56.6	541	0.158	0.094	CCT14_ARATH Cyclin-T1-4 OS=Arabidopsis thaliana OX=3702 GN=CYCT1-4 PE=1 SV=1
17	O74627	1.05e-07	55.1	342	0.173	0.164	CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pch1 PE=1 SV=1
18	O17869	2.66e-07	53.1	252	0.121	0.155	O17869_CAEEL Cyclin-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccnk-1 PE=1 SV=2
19	Q8IKK0	2.45e-06	50.8	326	0.149	0.147	Q8IKK0_PLAF7 Cyclin 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1463700 PE=3 SV=1
20	Q5A4H9	7.42e-06	49.7	434	0.173	0.129	SSN8_CANAL RNA polymerase II holoenzyme cyclin-like subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN8 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02739 5_3_exonuc_N	3.4e+02	12.5	5'-3' exonuclease, N-terminal resolvase-like domain
2	PF02984 Cyclin_C	47	15.5	Cyclin, C-terminal domain
3	PF16899 Cyclin_C_2	1.3e-22	91.5	Cyclin C-terminal domain
4	PF00134 Cyclin_N	1.3e-05	36.3	Cyclin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256897

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256443	0.999	Cyclin-dependent kinase 7
2	9606.ENSP00000259895	0.999	General transcription factor IIH subunit 4
3	9606.ENSP00000261245	0.999	CDK-activating kinase assembly factor MAT1
4	9606.ENSP00000265963	0.999	General transcription factor IIH subunit 1
5	9606.ENSP00000285398	0.999	TFIIH basal transcription factor complex helicase XPB subunit
6	9606.ENSP00000328901	0.999	General transcription factor IIH subunit 2
7	9606.ENSP00000375809	0.999	TFIIH basal transcription factor complex helicase XPD subunit
8	9606.ENSP00000445162	0.999	General transcription factor IIH subunit 3
9	9606.ENSP00000476100	0.999	General transcription factor IIH subunit 5
10	9606.ENSP00000266970	0.998	Cyclin-dependent kinase 2
11	9606.ENSP00000283875	0.996	General transcription factor IIE subunit 1
12	9606.ENSP00000348168	0.996	Transcription initiation factor IIE subunit beta
13	9606.ENSP00000362361	0.993	Cyclin-dependent kinase 9
14	9606.ENSP00000480158	0.991	DNA-directed RNA polymerase II subunit RPB1
15	9606.ENSP00000378699	0.983	Cyclin-dependent kinase 1
16	9606.ENSP00000261900	0.979	Cyclin-T1
17	9606.ENSP00000265734	0.977	Cyclin-dependent kinase 6
18	9606.ENSP00000322343	0.975	Cyclin-dependent kinase 20
19	9606.ENSP00000257904	0.974	Cyclin-dependent kinase 4
20	9606.ENSP00000274026	0.972	Cyclin-A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016251	0.998	RNA polymerase II general transcription initiation factor activity
GO:0005515	0.997	protein binding
GO:0016538	0.996	cyclin-dependent protein serine/threonine kinase regulator activity
GO:0003824	0.921	catalytic activity
GO:0016740	0.826	transferase activity
GO:0016772	0.697	transferase activity, transferring phosphorus-containing groups
GO:1901363	0.306	heterocyclic compound binding
GO:0097159	0.305	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.989	regulation of primary metabolic process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0009987	0.978	cellular process
GO:0051338	0.978	regulation of transferase activity
GO:0051726	0.977	regulation of cell cycle
GO:0019220	0.976	regulation of phosphate metabolic process
GO:0043549	0.974	regulation of kinase activity
GO:0044237	0.972	cellular metabolic process
GO:0071704	0.970	organic substance metabolic process
GO:0044238	0.970	primary metabolic process
GO:0031399	0.967	regulation of protein modification process
GO:0006807	0.964	nitrogen compound metabolic process
GO:0000079	0.958	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0043170	0.956	macromolecule metabolic process
GO:0010564	0.938	regulation of cell cycle process
GO:0034641	0.890	cellular nitrogen compound metabolic process
GO:0090304	0.861	nucleic acid metabolic process
GO:0048518	0.779	positive regulation of biological process
GO:0048522	0.736	positive regulation of cellular process
GO:0006366	0.731	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.992	protein-containing complex
GO:0005737	0.912	cytoplasm
GO:0043073	0.893	germ cell nucleus
GO:0140513	0.854	nuclear protein-containing complex
GO:1990234	0.853	transferase complex
GO:0061695	0.823	transferase complex, transferring phosphorus-containing groups
GO:0140535	0.792	intracellular protein-containing complex
GO:0005667	0.709	transcription regulator complex
GO:0090575	0.661	RNA polymerase II transcription regulator complex
GO:0055029	0.653	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.638	RNA polymerase II, holoenzyme
GO:1902554	0.628	serine/threonine protein kinase complex
GO:0005675	0.445	transcription factor TFIIH holo complex
GO:0043232	0.385	intracellular non-membrane-bounded organelle
GO:0000307	0.368	cyclin-dependent protein kinase holoenzyme complex
GO:0005829	0.318	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.826	Transferases.
EC:2.7.-.-	0.697	Transferring phosphorus-containing groups.

[back to server]