StarFunc result for job id P51948

User Input

>input (309 residues)
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRV
QLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKK
KMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNK
QAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHK
LEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA
FSGLFWQPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R688	0.744	0.744	4.409E-47	309	1.000	1.000	A0A024R688.pdb.gz	A0A024R688_HUMAN CDK-activating kinase assembly factor MAT1 (Fragment) OS=Homo sapiens OX=9606 GN=MNAT1 PE=2 SV=1
2	PDB:7lbmd	0.533	0.589	4.073E-34	275	0.887	0.996	7lbmd.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
3	AFDB:Q7KPG8	0.532	0.515	1.165E-31	320	0.534	0.516	Q7KPG8.pdb.gz	Q7KPG8_DROME CDK-activating kinase assembly factor MAT1 OS=Drosophila melanogaster OX=7227 GN=Mat1 PE=1 SV=1
4	PDB:6o9l3	0.362	0.362	2.224E-30	309	1.000	1.000	6o9l3.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
5	PDB:7nvr3	0.419	0.586	1.713E-26	214	0.693	1.000	7nvr3.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
6	PDB:7egb0	0.477	0.614	8.538E-26	234	0.757	1.000	7egb0.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
7	AFDB:O94684	0.580	0.566	5.203E-17	318	0.298	0.289	O94684.pdb.gz	TFB3_SCHPO RNA polymerase II transcription factor B subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmh1 PE=1 SV=1
8	AFDB:Q03290	0.550	0.532	8.234E-17	321	0.294	0.283	Q03290.pdb.gz	TFB3_YEAST RNA polymerase II transcription factor B subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFB3 PE=1 SV=1
9	AFDB:Q8I3Y3	0.272	0.312	1.842E-9	260	0.191	0.227	Q8I3Y3.pdb.gz	Q8I3Y3_PLAF7 CDK-activating kinase assembly factor MAT1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0512300 PE=4 SV=1
10	PDB:6gym3	0.371	0.748	2.795E-8	138	0.194	0.435	6gym3.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
11	AFDB:Q84K40	0.261	0.444	1.128E-5	178	0.178	0.309	Q84K40.pdb.gz	Q84K40_ARATH Cyclin-dependent kinase-activating kinase assembly factor-related / CDK-activating kinase assembly factor-like protein OS=Arabidopsis thaliana OX=3702 GN=At4g30820 PE=1 SV=1
12	AFDB:Q9VWI4	0.186	0.263	2.945E-3	211	0.129	0.190	Q9VWI4.pdb.gz	NARYA_DROME RING finger protein narya OS=Drosophila melanogaster OX=7227 GN=narya PE=1 SV=1
13	AFDB:P43254	0.168	0.080	5.536E-3	675	0.172	0.079	P43254.pdb.gz	COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana OX=3702 GN=COP1 PE=1 SV=2
14	AFDB:Q7K2X1	0.185	0.133	8.271E-3	435	0.223	0.159	Q7K2X1.pdb.gz	Q7K2X1_DROME GH03577p OS=Drosophila melanogaster OX=7227 GN=nopo PE=2 SV=1
15	AFDB:Q8IMM9	0.167	0.227	8.271E-3	219	0.142	0.201	Q8IMM9.pdb.gz	NENYA_DROME RING finger protein nenya OS=Drosophila melanogaster OX=7227 GN=nenya PE=2 SV=1
16	PDB:7oniR	0.123	0.357	7.928E-2	86	0.042	0.151	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
17	PDB:7dvq9	0.163	0.125	2.497E-1	409	0.039	0.029	7dvq9.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:7z36B	0.167	0.122	4.432E-1	446	0.146	0.101	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
19	PDB:5gm6a	0.141	0.333	5.575E-1	123	0.045	0.114	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:5dkaA	0.133	0.390	5.905E-1	96	0.045	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R688	0.0	636	309	1.000	1.000	A0A024R688_HUMAN CDK-activating kinase assembly factor MAT1 (Fragment) OS=Homo sapiens OX=9606 GN=MNAT1 PE=2 SV=1
2	A0A8I5ZYY1	0.0	521	302	0.883	0.904	A0A8I5ZYY1_RAT CDK-activating kinase assembly factor MAT1 OS=Rattus norvegicus OX=10116 GN=Mnat1 PE=1 SV=1
3	C9K507	0.0	626	309	0.984	0.984	C9K507_PIG CDK-activating kinase assembly factor MAT1 OS=Sus scrofa OX=9823 GN=MNAT1 PE=2 SV=1
4	F7EX11	0.0	582	309	0.958	0.958	F7EX11_RAT CDK-activating kinase assembly factor MAT1 OS=Rattus norvegicus OX=10116 GN=Mnat1 PE=1 SV=1
5	P51948	0.0	636	309	1.000	1.000	MAT1_HUMAN CDK-activating kinase assembly factor MAT1 OS=Homo sapiens OX=9606 GN=MNAT1 PE=1 SV=1
6	P51949	0.0	582	309	0.955	0.955	MAT1_MOUSE CDK-activating kinase assembly factor MAT1 OS=Mus musculus OX=10090 GN=Mnat1 PE=1 SV=2
7	A0A8I6ATM4	7.43e-179	496	282	0.835	0.915	A0A8I6ATM4_RAT CDK-activating kinase assembly factor MAT1 OS=Rattus norvegicus OX=10116 GN=Mnat1 PE=1 SV=1
8	A0A8I5ZV40	1.95e-155	436	262	0.748	0.882	A0A8I5ZV40_RAT MNAT1 component of CDK activating kinase OS=Rattus norvegicus OX=10116 GN=Mnat1 PE=1 SV=1
9	H0YJ92	6.84e-121	345	169	0.547	1.000	H0YJ92_HUMAN MNAT1 component of CDK activating kinase (Fragment) OS=Homo sapiens OX=9606 GN=MNAT1 PE=1 SV=1
10	Q7KPG8	3.62e-115	337	320	0.544	0.525	Q7KPG8_DROME CDK-activating kinase assembly factor MAT1 OS=Drosophila melanogaster OX=7227 GN=Mat1 PE=1 SV=1
11	Q8SX08	4.26e-115	337	320	0.544	0.525	Q8SX08_DROME CDK-activating kinase assembly factor MAT1 OS=Drosophila melanogaster OX=7227 GN=Mat1 PE=2 SV=1
12	H0YJF2	2.10e-114	329	173	0.534	0.954	H0YJF2_HUMAN MNAT1 component of CDK activating kinase (Fragment) OS=Homo sapiens OX=9606 GN=MNAT1 PE=1 SV=1
13	O94684	1.20e-38	140	318	0.236	0.230	TFB3_SCHPO RNA polymerase II transcription factor B subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmh1 PE=1 SV=1
14	Q03290	2.38e-35	132	321	0.301	0.290	TFB3_YEAST RNA polymerase II transcription factor B subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFB3 PE=1 SV=1
15	Q84K40	7.13e-16	76.3	178	0.100	0.174	Q84K40_ARATH Cyclin-dependent kinase-activating kinase assembly factor-related / CDK-activating kinase assembly factor-like protein OS=Arabidopsis thaliana OX=3702 GN=At4g30820 PE=1 SV=1
16	Q8I3Y3	3.86e-11	64.3	260	0.162	0.192	Q8I3Y3_PLAF7 CDK-activating kinase assembly factor MAT1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0512300 PE=4 SV=1
17	Q1MTQ0	1.45e-04	45.8	692	0.055	0.025	BRL1_SCHPO E3 ubiquitin-protein ligase brl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brl1 PE=1 SV=1
18	H2KYH3	0.011	40.0	2476	0.052	0.006	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
19	P34537	0.039	38.1	837	0.052	0.019	BRE1_CAEEL E3 ubiquitin-protein ligase bre-1 OS=Caenorhabditis elegans OX=6239 GN=rfp-1 PE=1 SV=2
20	Q86WT6	0.057	37.4	500	0.084	0.052	TRI69_HUMAN E3 ubiquitin-protein ligase TRIM69 OS=Homo sapiens OX=9606 GN=TRIM69 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03119 DNA_ligase_ZBD	6.4e+02	11.8	NAD-dependent DNA ligase C4 zinc finger domain
2	PF18912 DZR_2	29	16.0	Double zinc ribbon domain
3	PF04791 LMBR1	4.2e+02	11.2	LMBR1-like membrane protein
4	PF06391 MAT1	6.2e-58	207.5	CDK-activating kinase assembly factor MAT1
5	PF08440 Poty_PP	8.9e+02	10.3	Potyviridae polyprotein
6	PF14447 Prok-RING_4	1.8e+02	13.4	Prokaryotic RING finger family 4
7	PF00097 zf-C3HC4	3.4	18.9	Zinc finger, C3HC4 type (RING finger)
8	PF13923 zf-C3HC4_2	86	14.4	Zinc finger, C3HC4 type (RING finger)
9	PF17121 zf-C3HC4_5	5.6e-10	50.3	Zinc finger, C3HC4 type (RING finger)
10	PF03854 zf-P11	6.4e+02	11.4	P-11 zinc finger
11	PF13639 zf-RING_2	36	16.1	Ring finger domain
12	PF14570 zf-RING_4	6.4e+02	11.5	RING/Ubox like zinc-binding domain
13	PF14634 zf-RING_5	0.28	22.5	zinc-RING finger domain
14	PF13445 zf-RING_UBOX	0.9	20.9	RING-type zinc-finger
15	PF14569 zf-UDP	1.4e+02	14.0	Zinc-binding RING-finger
16	PF07191 zinc-ribbons_6	3.4e+02	12.6	zinc-ribbons

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000016742

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002394	0.999	Uncharacterized protein
2	61853.ENSNLEP00000016516	0.999	Cyclin H
3	61853.ENSNLEP00000019016	0.999	ERCC excision repair 3, TFIIH core complex helicase subunit
4	61853.ENSNLEP00000021572	0.999	General transcription factor IIH, polypeptide 1, 62kDa
5	61853.ENSNLEP00000002325	0.995	General transcription factor IIH, polypeptide 3, 34kDa
6	61853.ENSNLEP00000006799	0.995	General transcription factor IIH subunit 4
7	61853.ENSNLEP00000005335	0.994	Uncharacterized protein
8	61853.ENSNLEP00000023851	0.994	Uncharacterized protein
9	61853.ENSNLEP00000024048	0.994	Belongs to the protein kinase superfamily.
10	61853.ENSNLEP00000013166	0.991	General transcription factor IIH, polypeptide 5
11	61853.ENSNLEP00000014492	0.981	General transcription factor IIE, polypeptide 2, beta 34kDa
12	61853.ENSNLEP00000006218	0.974	General transcription factor IIE, polypeptide 1, alpha 56kDa
13	61853.ENSNLEP00000002392	0.969	Uncharacterized protein
14	61853.ENSNLEP00000011555	0.964	DNA-directed RNA polymerase subunit
15	61853.ENSNLEP00000012452	0.957	General transcription factor IIB
16	61853.ENSNLEP00000019300	0.955	General transcription factor IIF, polypeptide 1, 74kDa
17	61853.ENSNLEP00000004949	0.953	Polymerase (RNA) II (DNA directed) polypeptide G
18	61853.ENSNLEP00000006574	0.949	Cyclin-dependent kinase 20
19	61853.ENSNLEP00000019129	0.948	Polymerase (RNA) II (DNA directed) polypeptide D
20	61853.ENSNLEP00000014230	0.932	DNA-directed RNA polymerase subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008270	0.941	zinc ion binding
GO:0003824	0.430	catalytic activity
GO:0016740	0.390	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0044770	0.996	cell cycle phase transition
GO:0048518	0.995	positive regulation of biological process
GO:0048522	0.992	positive regulation of cellular process
GO:0044772	0.985	mitotic cell cycle phase transition
GO:0044843	0.982	cell cycle G1/S phase transition
GO:0000082	0.971	G1/S transition of mitotic cell cycle
GO:0042127	0.967	regulation of cell population proliferation
GO:0048660	0.960	regulation of smooth muscle cell proliferation
GO:0010941	0.955	regulation of cell death
GO:0048661	0.944	positive regulation of smooth muscle cell proliferation
GO:0043066	0.937	negative regulation of apoptotic process
GO:0071704	0.863	organic substance metabolic process
GO:0006807	0.831	nitrogen compound metabolic process
GO:0044237	0.829	cellular metabolic process
GO:0044238	0.828	primary metabolic process
GO:0043170	0.804	macromolecule metabolic process
GO:0019222	0.768	regulation of metabolic process
GO:1901360	0.762	organic cyclic compound metabolic process
GO:0034641	0.752	cellular nitrogen compound metabolic process
GO:0006139	0.723	nucleobase-containing compound metabolic process
GO:0080090	0.715	regulation of primary metabolic process
GO:0060255	0.715	regulation of macromolecule metabolic process
GO:0051171	0.712	regulation of nitrogen compound metabolic process
GO:0031323	0.712	regulation of cellular metabolic process
GO:0090304	0.673	nucleic acid metabolic process
GO:0019219	0.610	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.547	regulation of cellular biosynthetic process
GO:0010467	0.533	gene expression
GO:1901576	0.515	organic substance biosynthetic process
GO:0044249	0.514	cellular biosynthetic process
GO:0016070	0.505	RNA metabolic process
GO:0010556	0.498	regulation of macromolecule biosynthetic process
GO:0051252	0.498	regulation of RNA metabolic process
GO:1901362	0.495	organic cyclic compound biosynthetic process
GO:0010468	0.493	regulation of gene expression
GO:0044271	0.488	cellular nitrogen compound biosynthetic process
GO:2001141	0.486	regulation of RNA biosynthetic process
GO:0006355	0.483	regulation of DNA-templated transcription
GO:0034654	0.478	nucleobase-containing compound biosynthetic process
GO:0050896	0.417	response to stimulus
GO:0097659	0.413	nucleic acid-templated transcription
GO:0006351	0.399	DNA-templated transcription
GO:0006366	0.313	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0005737	0.959	cytoplasm
GO:1990234	0.911	transferase complex
GO:0061695	0.903	transferase complex, transferring phosphorus-containing groups
GO:0140513	0.897	nuclear protein-containing complex
GO:0140535	0.839	intracellular protein-containing complex
GO:0005667	0.833	transcription regulator complex
GO:1902554	0.830	serine/threonine protein kinase complex
GO:0005694	0.803	chromosome
GO:0090575	0.750	RNA polymerase II transcription regulator complex
GO:0055029	0.741	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.730	RNA polymerase II, holoenzyme
GO:0032806	0.618	carboxy-terminal domain protein kinase complex
GO:0005675	0.528	transcription factor TFIIH holo complex
GO:0000307	0.344	cyclin-dependent protein kinase holoenzyme complex
GO:0150005	0.308	enzyme activator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.390	Transferases.

[back to server]