StarFunc result for job id P51955

User Input

>input (445 residues)
MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLR
ELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQL
TLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTP
YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSS
PVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKE
RKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAA
QLRAQALSDIEKNYQLKSRQILGMR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51955	1.000	1.000	1.890E-75	445	1.000	1.000	P51955.pdb.gz	NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens OX=9606 GN=NEK2 PE=1 SV=1
2	AFDB:O35942	0.731	0.735	3.709E-64	443	0.876	0.880	O35942.pdb.gz	NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus OX=10090 GN=Nek2 PE=1 SV=2
3	AFDB:Q7ZUN2	0.776	0.784	1.377E-56	440	0.674	0.682	Q7ZUN2.pdb.gz	Q7ZUN2_DANRE NIMA (Never in mitosis gene a)-related kinase 2 OS=Danio rerio OX=7955 GN=zgc:55602 PE=2 SV=1
4	AFDB:Q55BN8	0.595	0.632	1.933E-38	418	0.396	0.421	Q55BN8.pdb.gz	NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum OX=44689 GN=nek2 PE=1 SV=1
5	AFDB:P11837	0.593	0.383	9.902E-34	699	0.346	0.220	P11837.pdb.gz	NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nimA PE=1 SV=1
6	AFDB:G5EHL3	0.597	0.455	1.392E-33	591	0.351	0.264	G5EHL3.pdb.gz	G5EHL3_MAGO7 NEK protein kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGCH7_ch7g813 PE=4 SV=1
7	AFDB:O13839	0.605	0.378	1.747E-33	722	0.351	0.216	O13839.pdb.gz	FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fin1 PE=3 SV=1
8	AFDB:Q9W3N8	0.579	0.355	4.094E-33	735	0.380	0.230	Q9W3N8.pdb.gz	Q9W3N8_DROME LD04361p OS=Drosophila melanogaster OX=7227 GN=Nek2 PE=2 SV=1
9	AFDB:P48479	0.591	0.314	5.438E-33	858	0.333	0.172	P48479.pdb.gz	NIM1_NEUCR G2-specific protein kinase nim-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=nim-1 PE=2 SV=2
10	AFDB:Q38CJ2	0.581	0.343	1.725E-29	764	0.321	0.187	Q38CJ2.pdb.gz	Q38CJ2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7860 PE=4 SV=1
11	PDB:6s73A	0.538	0.873	6.542E-24	269	0.207	0.342	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
12	PDB:4ek6A	0.490	0.765	9.918E-21	279	0.169	0.269	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
13	PDB:4d28C	0.518	0.800	1.653E-20	279	0.180	0.287	4d28C.pdb.gz
14	PDB:5u6yA	0.499	0.484	1.960E-20	459	0.182	0.176	5u6yA.pdb.gz
15	PDB:4c0tA	0.518	0.773	2.917E-20	291	0.169	0.258	4c0tA.pdb.gz
16	PDB:4zhxA	0.520	0.564	1.017E-19	409	0.196	0.213	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
17	PDB:6b1uA	0.518	0.521	1.794E-19	442	0.182	0.183	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
18	PDB:4eomC	0.503	0.794	2.252E-19	276	0.171	0.275	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
19	PDB:8bfsA	0.485	0.757	2.383E-19	274	0.164	0.266	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
20	PDB:3eqdA	0.526	0.728	3.546E-19	315	0.160	0.225	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F6U4U2	0.0	766	388	0.834	0.956	F6U4U2_HUMAN NIMA related kinase 2 OS=Homo sapiens OX=9606 GN=NEK2 PE=1 SV=1
2	O35942	0.0	759	443	0.881	0.885	NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus OX=10090 GN=Nek2 PE=1 SV=2
3	P51955	0.0	911	445	1.000	1.000	NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens OX=9606 GN=NEK2 PE=1 SV=1
4	Q7ZUN2	0.0	596	440	0.679	0.686	Q7ZUN2_DANRE NIMA (Never in mitosis gene a)-related kinase 2 OS=Danio rerio OX=7955 GN=zgc:55602 PE=2 SV=1
5	Q55BN8	1.79e-111	336	418	0.371	0.395	NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum OX=44689 GN=nek2 PE=1 SV=1
6	Q9W3N8	1.51e-95	305	735	0.299	0.181	Q9W3N8_DROME LD04361p OS=Drosophila melanogaster OX=7227 GN=Nek2 PE=2 SV=1
7	P11837	7.92e-81	265	699	0.326	0.207	NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nimA PE=1 SV=1
8	O13839	9.26e-74	247	722	0.312	0.193	FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fin1 PE=3 SV=1
9	P48479	1.14e-72	246	858	0.290	0.150	NIM1_NEUCR G2-specific protein kinase nim-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=nim-1 PE=2 SV=2
10	G5EHL3	3.06e-70	234	591	0.328	0.247	G5EHL3_MAGO7 NEK protein kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGCH7_ch7g813 PE=4 SV=1
11	P22209	1.46e-66	221	435	0.328	0.336	KIN3_YEAST Serine/threonine-protein kinase KIN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIN3 PE=3 SV=2
12	Q57V67	3.86e-61	208	503	0.276	0.245	Q57V67_TRYB2 Serine/threonine-protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.210 PE=4 SV=1
13	P51956	1.21e-59	204	506	0.249	0.219	NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens OX=9606 GN=NEK3 PE=1 SV=2
14	P51954	2.27e-59	212	1203	0.254	0.094	NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus OX=10090 GN=Nek1 PE=1 SV=2
15	Q96PY6	2.61e-59	212	1258	0.258	0.091	NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1 PE=1 SV=2
16	Q9R0A5	4.01e-59	203	511	0.292	0.254	NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus OX=10090 GN=Nek3 PE=1 SV=2
17	Q5M813	3.13e-58	195	309	0.249	0.359	Q5M813_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=2 SV=1
18	Q38CJ2	1.00e-57	204	764	0.303	0.177	Q38CJ2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7860 PE=4 SV=1
19	A0A8I5ZKL8	3.37e-55	197	743	0.249	0.149	A0A8I5ZKL8_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
20	A0A8I5ZLB3	4.75e-55	197	756	0.249	0.147	A0A8I5ZLB3_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.38	21.4	ABC1 atypical kinase-like domain
2	PF01636 APH	2.1e+02	13.2	Phosphotransferase enzyme family
3	PF14531 Kinase-like	0.024	25.5	Kinase-like
4	PF00069 Pkinase	2.9e-59	212.2	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	8.2e-39	145.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355966

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261597	0.999	Kinetochore protein NDC80 homolog
2	9606.ENSP00000361540	0.999	Cell division cycle protein 20 homolog
3	9606.ENSP00000353549	0.991	Cell division cycle protein 16 homolog
4	9606.ENSP00000287598	0.989	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
5	9606.ENSP00000426654	0.988	Anaphase-promoting complex subunit 4
6	9606.ENSP00000363322	0.985	Anaphase-promoting complex subunit CDC26
7	9606.ENSP00000378350	0.983	Cell division cycle protein 23 homolog
8	9606.ENSP00000434614	0.982	Cell division cycle protein 27 homolog
9	9606.ENSP00000288207	0.980	G2/mitotic-specific cyclin-B2
10	9606.ENSP00000339109	0.979	Anaphase-promoting complex subunit 1
11	9606.ENSP00000341779	0.979	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
12	9606.ENSP00000302530	0.973	Mitotic checkpoint serine/threonine-protein kinase BUB1
13	9606.ENSP00000260731	0.969	Kinesin-like protein KIF11
14	9606.ENSP00000348838	0.969	Ubiquitin-conjugating enzyme E2 C
15	9606.ENSP00000274026	0.967	Cyclin-A2
16	9606.ENSP00000296509	0.967	Mitotic spindle assembly checkpoint protein MAD2A
17	9606.ENSP00000439403	0.966	Anaphase-promoting complex subunit 15
18	9606.ENSP00000247191	0.961	Disks large-associated protein 5
19	9606.ENSP00000355922	0.961	Centromere protein F
20	9606.ENSP00000394394	0.960	Anaphase-promoting complex subunit 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.323	enzyme binding
GO:0019902	0.307	phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.987	biological regulation
GO:0007017	0.985	microtubule-based process
GO:0022402	0.985	cell cycle process
GO:0007010	0.985	cytoskeleton organization
GO:0000226	0.983	microtubule cytoskeleton organization
GO:0043170	0.981	macromolecule metabolic process
GO:0050789	0.978	regulation of biological process
GO:0044237	0.977	cellular metabolic process
GO:0050794	0.973	regulation of cellular process
GO:0044238	0.959	primary metabolic process
GO:0006807	0.958	nitrogen compound metabolic process
GO:0007059	0.942	chromosome segregation
GO:0007051	0.942	spindle organization
GO:0016310	0.939	phosphorylation
GO:0070925	0.937	organelle assembly
GO:0036211	0.936	protein modification process
GO:0140694	0.932	non-membrane-bounded organelle assembly
GO:0006468	0.898	protein phosphorylation
GO:0051225	0.889	spindle assembly
GO:0033044	0.880	regulation of chromosome organization
GO:0048518	0.860	positive regulation of biological process
GO:0019222	0.826	regulation of metabolic process
GO:0051726	0.803	regulation of cell cycle
GO:0065009	0.801	regulation of molecular function
GO:0060255	0.792	regulation of macromolecule metabolic process
GO:0080090	0.782	regulation of primary metabolic process
GO:0051171	0.782	regulation of nitrogen compound metabolic process
GO:1903047	0.779	mitotic cell cycle process
GO:0031323	0.775	regulation of cellular metabolic process
GO:0048522	0.708	positive regulation of cellular process
GO:2000278	0.707	regulation of DNA biosynthetic process
GO:0007098	0.688	centrosome cycle
GO:0032204	0.616	regulation of telomere maintenance
GO:0010564	0.512	regulation of cell cycle process
GO:1904356	0.482	regulation of telomere maintenance via telomere lengthening
GO:0050790	0.466	regulation of catalytic activity
GO:0009893	0.402	positive regulation of metabolic process
GO:0010604	0.391	positive regulation of macromolecule metabolic process
GO:0048519	0.325	negative regulation of biological process
GO:0032210	0.322	regulation of telomere maintenance via telomerase
GO:0051173	0.308	positive regulation of nitrogen compound metabolic process
GO:0051783	0.307	regulation of nuclear division

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	0.999	microtubule cytoskeleton
GO:0005654	0.999	nucleoplasm
GO:0032991	0.992	protein-containing complex
GO:0005737	0.986	cytoplasm
GO:0005813	0.985	centrosome
GO:0005694	0.973	chromosome
GO:0005829	0.957	cytosol
GO:0000793	0.893	condensed chromosome
GO:0005819	0.829	spindle
GO:0098687	0.827	chromosomal region
GO:0099080	0.772	supramolecular complex
GO:0000779	0.365	condensed chromosome, centromeric region
GO:0000776	0.351	kinetochore

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]