StarFunc result for job id P51956

User Input

>input (506 residues)
MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHP
NIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHK
KRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYN
NKSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKR
NPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRI
ALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHLRKASSPNLHR
RQWEKNVPNTALTALENASILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILK
NADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTD
FEEEDDNPDWVSELKKRAGWQGLCDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51956	1.000	1.000	4.506E-86	506	1.000	1.000	P51956.pdb.gz	NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens OX=9606 GN=NEK3 PE=1 SV=2
2	AFDB:Q9R0A5	0.701	0.694	1.547E-60	511	0.739	0.732	Q9R0A5.pdb.gz	NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus OX=10090 GN=Nek3 PE=1 SV=2
3	AFDB:Q7TSC3	0.549	0.448	3.485E-35	627	0.374	0.301	Q7TSC3.pdb.gz	NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus OX=10090 GN=Nek5 PE=2 SV=1
4	AFDB:Q9LT35	0.520	0.630	7.880E-30	416	0.247	0.300	Q9LT35.pdb.gz	NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana OX=3702 GN=NEK6 PE=3 SV=1
5	AFDB:Q6YY75	0.519	0.492	1.286E-28	534	0.285	0.270	Q6YY75.pdb.gz	NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica OX=39947 GN=NEK6 PE=1 SV=2
6	AFDB:Q91ZR4	0.474	0.347	5.503E-26	698	0.202	0.146	Q91ZR4.pdb.gz	NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus OX=10090 GN=Nek8 PE=1 SV=1
7	AFDB:Q90XC2	0.478	0.350	6.901E-25	697	0.208	0.151	Q90XC2.pdb.gz	NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio OX=7955 GN=nek8 PE=2 SV=1
8	AFDB:O01775	0.488	0.685	8.083E-25	357	0.213	0.303	O01775.pdb.gz	NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans OX=6239 GN=nekl-2 PE=2 SV=1
9	AFDB:Q57V67	0.481	0.484	8.981E-25	503	0.243	0.245	Q57V67.pdb.gz	Q57V67_TRYB2 Serine/threonine-protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.210 PE=4 SV=1
10	AFDB:Q8TD19	0.506	0.264	2.318E-24	979	0.219	0.113	Q8TD19.pdb.gz	NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2
11	PDB:5u6yA	0.471	0.518	2.997E-22	459	0.174	0.192	5u6yA.pdb.gz
12	PDB:7myjC	0.509	0.551	5.155E-21	465	0.154	0.168	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
13	PDB:5ufuA	0.485	0.658	1.023E-20	369	0.146	0.201	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
14	PDB:6b1uA	0.511	0.582	1.403E-20	442	0.148	0.170	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
15	PDB:4zhxA	0.502	0.615	3.259E-20	409	0.142	0.176	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
16	PDB:4rerA	0.493	0.542	9.348E-20	459	0.164	0.181	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:4eomC	0.472	0.847	9.854E-20	276	0.154	0.283	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
18	PDB:3c4wB	0.469	0.458	1.425E-19	519	0.140	0.137	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
19	PDB:1unlA	0.462	0.782	2.979E-19	292	0.154	0.267	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:4rewA	0.501	0.609	3.310E-19	411	0.156	0.192	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51956	0.0	1056	506	1.000	1.000	NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens OX=9606 GN=NEK3 PE=1 SV=2
2	Q9R0A5	0.0	724	511	0.741	0.734	NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus OX=10090 GN=Nek3 PE=1 SV=2
3	Q96PY6	1.65e-106	346	1258	0.298	0.120	NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1 PE=1 SV=2
4	P51954	1.82e-106	345	1203	0.298	0.126	NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus OX=10090 GN=Nek1 PE=1 SV=2
5	Q7TSC3	3.59e-104	326	627	0.287	0.231	NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus OX=10090 GN=Nek5 PE=2 SV=1
6	Q5M813	1.95e-81	257	309	0.227	0.372	Q5M813_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=2 SV=1
7	A0A8I5ZKL8	1.32e-77	259	743	0.221	0.151	A0A8I5ZKL8_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
8	P51957	2.45e-77	261	841	0.221	0.133	NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=2
9	D3ZDV9	2.66e-77	260	793	0.221	0.141	D3ZDV9_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=4 SV=2
10	Q9Z1J2	4.39e-77	259	792	0.219	0.140	NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus OX=10090 GN=Nek4 PE=1 SV=1
11	A0A8I5ZLB3	4.43e-77	258	756	0.221	0.148	A0A8I5ZLB3_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
12	A0A8I6A574	5.76e-77	259	829	0.221	0.135	A0A8I6A574_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
13	Q38CJ2	7.01e-76	255	764	0.237	0.157	Q38CJ2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7860 PE=4 SV=1
14	Q388G0	2.28e-75	261	1506	0.243	0.082	Q388G0_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2330 PE=4 SV=1
15	Q9LT35	3.98e-68	226	416	0.241	0.293	NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana OX=3702 GN=NEK6 PE=3 SV=1
16	Q6YY75	8.63e-66	223	534	0.215	0.204	NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica OX=39947 GN=NEK6 PE=1 SV=2
17	Q6ZEZ5	7.00e-65	222	585	0.208	0.179	NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica OX=39947 GN=NEK3 PE=1 SV=1
18	Q8NG66	1.67e-64	223	645	0.215	0.169	NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens OX=9606 GN=NEK11 PE=1 SV=2
19	Q0WPH8	3.51e-64	226	956	0.217	0.115	NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana OX=3702 GN=NEK5 PE=1 SV=1
20	Q57V67	9.31e-64	217	503	0.213	0.215	Q57V67_TRYB2 Serine/threonine-protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.210 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.067	23.9	ABC1 atypical kinase-like domain
2	PF01636 APH	0.88	20.9	Phosphotransferase enzyme family
3	PF06293 Kdo	11	16.9	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	0.0014	29.6	Kinase-like
5	PF00069 Pkinase	5.6e-65	230.9	Protein kinase domain
6	PF17667 Pkinase_fungal	1.6e+02	12.5	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	4.3e-42	155.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484443

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484403	0.764	Putative tyrosine-protein phosphatase TPTE
2	9606.ENSP00000482954	0.695	Prolactin receptor
3	9606.ENSP00000381133	0.692	Fibrinogen-like protein 1
4	9606.ENSP00000360916	0.665	Guanine nucleotide exchange factor VAV2
5	9606.ENSP00000472929	0.642	Proto-oncogene vav
6	9606.ENSP00000362047	0.641	XK-related protein 2
7	9606.ENSP00000480364	0.612	RCC1-like G exchanging factor-like protein
8	9606.ENSP00000327116	0.582	EH domain-containing protein 3
9	9606.ENSP00000360108	0.578	Putative tyrosine-protein phosphatase auxilin
10	9606.ENSP00000368402	0.519	BTB/POZ domain-containing protein KCTD4
11	9606.ENSP00000389414	0.504	Thromboxane-A synthase
12	9606.ENSP00000171887	0.503	Tensin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.983	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0050789	0.982	regulation of biological process
GO:0006807	0.950	nitrogen compound metabolic process
GO:0043170	0.946	macromolecule metabolic process
GO:0044237	0.944	cellular metabolic process
GO:1901564	0.940	organonitrogen compound metabolic process
GO:0016310	0.927	phosphorylation
GO:0050794	0.926	regulation of cellular process
GO:0044238	0.923	primary metabolic process
GO:0043412	0.911	macromolecule modification
GO:0019538	0.866	protein metabolic process
GO:0036211	0.852	protein modification process
GO:0006468	0.802	protein phosphorylation
GO:0071840	0.455	cellular component organization or biogenesis
GO:0048518	0.439	positive regulation of biological process
GO:0019222	0.427	regulation of metabolic process
GO:0016043	0.423	cellular component organization
GO:0060255	0.409	regulation of macromolecule metabolic process
GO:0080090	0.408	regulation of primary metabolic process
GO:0051171	0.402	regulation of nitrogen compound metabolic process
GO:0032501	0.331	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0005634	0.926	nucleus
GO:0005829	0.458	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]