StarFunc result for job id P51959

User Input

>input (295 residues)
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD
LIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE
RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTF
WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51959	1.000	1.000	1.157E-39	295	1.000	1.000	P51959.pdb.gz	CCNG1_HUMAN Cyclin-G1 OS=Homo sapiens OX=9606 GN=CCNG1 PE=1 SV=2
2	AFDB:Q8N5D4	0.881	0.760	2.421E-23	344	0.519	0.445	Q8N5D4.pdb.gz	Q8N5D4_HUMAN CCNG2 protein OS=Homo sapiens OX=9606 PE=1 SV=1
3	AFDB:O08918	0.865	0.745	3.010E-23	344	0.508	0.436	O08918.pdb.gz	CCNG2_MOUSE Cyclin-G2 OS=Mus musculus OX=10090 GN=Ccng2 PE=2 SV=3
4	AFDB:Q14094	0.728	0.576	5.354E-13	377	0.258	0.202	Q14094.pdb.gz	CCNI_HUMAN Cyclin-I OS=Homo sapiens OX=9606 GN=CCNI PE=1 SV=1
5	AFDB:Q95TJ9	0.772	0.418	1.977E-12	566	0.285	0.148	Q95TJ9.pdb.gz	CYCG_DROME Cyclin G OS=Drosophila melanogaster OX=7227 GN=CycG PE=1 SV=1
6	AFDB:Q9GTQ8	0.729	0.457	1.358E-9	481	0.200	0.123	Q9GTQ8.pdb.gz	Q9GTQ8_DROME Cyclin D OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
7	AFDB:P50755	0.711	0.721	2.098E-9	291	0.193	0.196	P50755.pdb.gz	CCND1_XENLA G1/S-specific cyclin-D1 OS=Xenopus laevis OX=8355 GN=ccnd1 PE=1 SV=1
8	AFDB:A3KPA9	0.675	0.621	2.609E-9	323	0.207	0.189	A3KPA9.pdb.gz	A3KPA9_DANRE LOC567411 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC567411 PE=2 SV=1
9	AFDB:Q90459	0.713	0.722	2.846E-9	291	0.200	0.203	Q90459.pdb.gz	CCND1_DANRE G1/S-specific cyclin-D1 OS=Danio rerio OX=7955 GN=ccnd1 PE=2 SV=1
10	AFDB:Q61456	0.680	0.489	5.013E-9	421	0.207	0.145	Q61456.pdb.gz	CCNA1_MOUSE Cyclin-A1 OS=Mus musculus OX=10090 GN=Ccna1 PE=1 SV=2
11	PDB:2w96A	0.708	0.830	1.117E-8	249	0.180	0.213	2w96A.pdb.gz
12	PDB:3g33B	0.696	0.883	4.125E-8	229	0.193	0.249	3g33B.pdb.gz
13	PDB:7b5lY	0.637	0.736	2.066E-7	253	0.220	0.257	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
14	PDB:1g3nC	0.681	0.849	5.875E-7	233	0.142	0.180	1g3nC.pdb.gz
15	PDB:7nj0C	0.716	0.778	8.694E-7	270	0.153	0.167	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
16	PDB:6gzhB	0.553	0.633	2.847E-4	252	0.142	0.167	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
17	PDB:7kpvB	0.568	0.577	3.862E-4	290	0.125	0.128	7kpvB.pdb.gz
18	PDB:1zp2A	0.520	0.655	6.803E-4	227	0.098	0.128	1zp2A.pdb.gz
19	PDB:7kueB	0.506	0.642	8.458E-4	225	0.125	0.164	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
20	PDB:5hbhB	0.553	0.600	1.007E-3	270	0.122	0.133	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P39950	0.0	565	294	0.932	0.935	CCNG1_RAT Cyclin-G1 OS=Rattus norvegicus OX=10116 GN=Ccng1 PE=2 SV=2
2	P51959	0.0	607	295	1.000	1.000	CCNG1_HUMAN Cyclin-G1 OS=Homo sapiens OX=9606 GN=CCNG1 PE=1 SV=2
3	Q8N5D4	9.71e-94	283	344	0.519	0.445	Q8N5D4_HUMAN CCNG2 protein OS=Homo sapiens OX=9606 PE=1 SV=1
4	O08918	1.31e-90	275	344	0.508	0.436	CCNG2_MOUSE Cyclin-G2 OS=Mus musculus OX=10090 GN=Ccng2 PE=2 SV=3
5	Q14094	3.97e-25	105	377	0.231	0.180	CCNI_HUMAN Cyclin-I OS=Homo sapiens OX=9606 GN=CCNI PE=1 SV=1
6	Q9Z2V9	6.90e-25	104	377	0.234	0.183	CCNI_MOUSE Cyclin-I OS=Mus musculus OX=10090 GN=Ccni PE=2 SV=4
7	Q95TJ9	1.16e-24	105	566	0.281	0.147	CYCG_DROME Cyclin G OS=Drosophila melanogaster OX=7227 GN=CycG PE=1 SV=1
8	Q5A1N6	3.56e-13	71.6	465	0.203	0.129	CG13_CANAL G1/S-specific cyclin CLN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CLN3 PE=1 SV=1
9	P51943	1.46e-11	66.6	422	0.173	0.121	CCNA2_MOUSE Cyclin-A2 OS=Mus musculus OX=10090 GN=Ccna2 PE=1 SV=2
10	A0JPK0	2.15e-11	65.9	338	0.159	0.139	A0JPK0_RAT Ccna2 protein OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=2 SV=1
11	A0A0G2JVY9	2.76e-11	65.9	418	0.159	0.112	A0A0G2JVY9_RAT Cyclin-A2 OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=3 SV=2
12	G3V802	2.87e-11	65.5	380	0.159	0.124	G3V802_RAT Cyclin A2 OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=1 SV=2
13	P20248	3.42e-11	65.5	432	0.156	0.106	CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2
14	P30274	4.32e-11	65.1	430	0.156	0.107	CCNA2_BOVIN Cyclin-A2 OS=Bos taurus OX=9913 GN=CCNA2 PE=1 SV=2
15	P43449	1.22e-10	63.9	395	0.163	0.122	CCNA2_CHICK Cyclin-A2 OS=Gallus gallus OX=9031 GN=CCNA2 PE=1 SV=1
16	P30183	1.38e-10	63.5	428	0.180	0.124	CCB11_ARATH Cyclin-B1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCB1-1 PE=1 SV=2
17	P14785	1.81e-09	60.5	491	0.136	0.081	CCNA_DROME G2/mitotic-specific cyclin-A OS=Drosophila melanogaster OX=7227 GN=CycA PE=1 SV=3
18	Q98TA3	2.41e-09	60.1	428	0.153	0.105	Q98TA3_DANRE Cyclin-A2 OS=Danio rerio OX=7955 GN=CycA2 PE=2 SV=1
19	Q6NV43	2.43e-09	60.1	428	0.153	0.105	Q6NV43_DANRE Cyclin-A2 OS=Danio rerio OX=7955 GN=chunp6924 PE=2 SV=2
20	P54733	3.30e-09	60.1	709	0.149	0.062	CCNE_DROME G1/S-specific cyclin-E OS=Drosophila melanogaster OX=7227 GN=CycE PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00134 Cyclin_N	1.1e-16	72.2	Cyclin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005653

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004551	0.968	MDM2 proto-oncogene, E3 ubiquitin protein ligase
2	61853.ENSNLEP00000011861	0.942	Cellular tumor antigen p53
3	61853.ENSNLEP00000021415	0.883	Serine/threonine-protein phosphatase 2A activator
4	61853.ENSNLEP00000009968	0.876	Cyclin G2
5	61853.ENSNLEP00000005013	0.825	Cyclin-dependent kinase 5
6	61853.ENSNLEP00000023993	0.800	Cyclin-dependent kinase 1
7	61853.ENSNLEP00000002132	0.764	Cell division control protein
8	61853.ENSNLEP00000022745	0.763	Cyclin-dependent kinase inhibitor 1A (p21, Cip1)
9	61853.ENSNLEP00000010650	0.753	Cyclin-dependent kinases regulatory subunit
10	61853.ENSNLEP00000014029	0.753	Cyclin-dependent kinases regulatory subunit
11	61853.ENSNLEP00000021326	0.753	Cyclin-dependent kinase 2
12	61853.ENSNLEP00000011422	0.744	Cyclin F
13	61853.ENSNLEP00000009397	0.705	Proliferating cell nuclear antigen
14	61853.ENSNLEP00000020905	0.703	Cyclin-dependent kinase 4
15	61853.ENSNLEP00000019153	0.695	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
16	61853.ENSNLEP00000009847	0.688	Protein phosphatase 2, catalytic subunit, alpha isozyme
17	61853.ENSNLEP00000002367	0.679	Belongs to the protein kinase superfamily.
18	61853.ENSNLEP00000001417	0.677	Cell division cycle 20B
19	61853.ENSNLEP00000003238	0.677	Fizzy/cell division cycle 20 related 1 (Drosophila)
20	61853.ENSNLEP00000016408	0.677	Cell division cycle 20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0051726	0.978	regulation of cell cycle
GO:0009987	0.937	cellular process
GO:0071900	0.879	regulation of protein serine/threonine kinase activity
GO:1904029	0.832	regulation of cyclin-dependent protein kinase activity
GO:0050896	0.504	response to stimulus
GO:0000079	0.487	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0010564	0.413	regulation of cell cycle process
GO:0048519	0.398	negative regulation of biological process
GO:0008152	0.391	metabolic process
GO:0022402	0.388	cell cycle process
GO:0048523	0.377	negative regulation of cellular process
GO:0048518	0.375	positive regulation of biological process
GO:0000278	0.372	mitotic cell cycle
GO:0051716	0.362	cellular response to stimulus
GO:0071704	0.349	organic substance metabolic process
GO:1901987	0.345	regulation of cell cycle phase transition
GO:0048522	0.339	positive regulation of cellular process
GO:0007346	0.320	regulation of mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.965	cytoplasm
GO:0032991	0.932	protein-containing complex
GO:0005829	0.679	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]