StarFunc result for job id P51965

User Input

>input (193 residues)
MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADIT
LDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY
HCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEH
DRMARQWTKRYAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51965	1.000	1.000	2.344E-38	193	1.000	1.000	P51965.pdb.gz	UB2E1_HUMAN Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens OX=9606 GN=UBE2E1 PE=1 SV=1
2	AFDB:Q96LR5	0.834	0.803	9.489E-34	201	0.845	0.811	Q96LR5.pdb.gz	UB2E2_HUMAN Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens OX=9606 GN=UBE2E2 PE=1 SV=1
3	AFDB:P52483	0.807	0.754	3.380E-33	207	0.803	0.749	P52483.pdb.gz	UB2E3_MOUSE Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus OX=10090 GN=Ube2e3 PE=1 SV=2
4	AFDB:P52485	0.771	0.642	2.541E-31	232	0.741	0.616	P52485.pdb.gz	UBCD2_DROME Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc2 PE=2 SV=1
5	PDB:3bzhA	0.765	0.916	3.869E-31	161	0.798	0.957	3bzhA.pdb.gz
6	AFDB:A5PKP9	0.759	0.996	1.657E-24	147	0.466	0.612	A5PKP9.pdb.gz	UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis OX=8355 GN=ube2d4 PE=1 SV=1
7	PDB:3ptfA	0.761	0.958	1.836E-24	153	0.477	0.601	3ptfA.pdb.gz
8	AFDB:Q9LJD7	0.774	0.819	2.004E-24	182	0.456	0.484	Q9LJD7.pdb.gz	COP10_ARATH Constitutive photomorphogenesis protein 10 OS=Arabidopsis thaliana OX=3702 GN=COP10 PE=1 SV=1
9	AFDB:Q9SLE4	0.754	0.982	2.136E-24	148	0.466	0.608	Q9SLE4.pdb.gz	UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana OX=3702 GN=UBC29 PE=2 SV=1
10	AFDB:P15731	0.758	0.987	2.754E-24	148	0.492	0.642	P15731.pdb.gz	UBC4_YEAST Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC4 PE=1 SV=1
11	AFDB:Q9FKT3	0.754	0.982	7.141E-24	148	0.466	0.608	Q9FKT3.pdb.gz	UBC30_ARATH Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana OX=3702 GN=UBC30 PE=1 SV=1
12	AFDB:F4JKF3	0.748	0.811	7.609E-24	178	0.461	0.500	F4JKF3.pdb.gz	F4JKF3_ARATH Ubiquitin conjugating enzyme 9 OS=Arabidopsis thaliana OX=3702 GN=UBC9 PE=3 SV=1
13	PDB:5aieB	0.757	0.970	4.128E-23	150	0.487	0.627	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
14	PDB:4x57C	0.756	0.976	6.862E-23	149	0.472	0.611	4x57C.pdb.gz
15	PDB:4ddgA	0.736	0.359	2.958E-22	399	0.482	0.233	4ddgA.pdb.gz
16	PDB:4ii2C	0.743	0.960	3.814E-22	149	0.482	0.624	4ii2C.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
17	PDB:4r8pL	0.736	0.562	2.086E-20	254	0.503	0.382	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
18	PDB:7jzvA	0.702	0.546	1.697E-19	253	0.492	0.375	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
19	PDB:4ccgA	0.723	0.884	2.154E-18	157	0.311	0.382	4ccgA.pdb.gz	Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.
20	PDB:6zhtB	0.747	0.938	7.675E-18	153	0.358	0.451	6zhtB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51965	4.18e-144	400	193	1.000	1.000	UB2E1_HUMAN Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens OX=9606 GN=UBE2E1 PE=1 SV=1
2	P52482	2.65e-142	395	193	0.990	0.990	UB2E1_MOUSE Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus OX=10090 GN=Ube2e1 PE=1 SV=1
3	Q96LR5	2.54e-119	338	201	0.850	0.816	UB2E2_HUMAN Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens OX=9606 GN=UBE2E2 PE=1 SV=1
4	P52483	1.52e-111	318	207	0.782	0.729	UB2E3_MOUSE Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus OX=10090 GN=Ube2e3 PE=1 SV=2
5	Q969T4	1.52e-111	318	207	0.782	0.729	UB2E3_HUMAN Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens OX=9606 GN=UBE2E3 PE=1 SV=1
6	P52485	1.20e-106	307	232	0.736	0.612	UBCD2_DROME Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc2 PE=2 SV=1
7	Q6FV50	1.24e-69	210	147	0.497	0.653	Q6FV50_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0E04752g PE=3 SV=1
8	P15732	2.57e-68	207	148	0.492	0.642	UBC5_YEAST Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC5 PE=1 SV=1
9	P15731	6.81e-68	206	148	0.487	0.635	UBC4_YEAST Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC4 PE=1 SV=1
10	Q8S920	6.96e-68	206	147	0.487	0.639	UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5A PE=2 SV=1
11	P35129	1.05e-67	205	147	0.492	0.646	UBC2_CAEEL Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditis elegans OX=6239 GN=let-70 PE=1 SV=1
12	P35134	1.26e-67	205	148	0.477	0.622	UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana OX=3702 GN=UBC11 PE=1 SV=2
13	D3ZDK2	4.77e-67	203	147	0.466	0.612	UB2D1_RAT Ubiquitin-conjugating enzyme E2 D1 OS=Rattus norvegicus OX=10116 GN=Ube2d1 PE=1 SV=1
14	P51668	4.77e-67	203	147	0.466	0.612	UB2D1_HUMAN Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens OX=9606 GN=UBE2D1 PE=1 SV=1
15	P61080	4.77e-67	203	147	0.466	0.612	UB2D1_MOUSE Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus OX=10090 GN=Ube2d1 PE=1 SV=1
16	P46595	4.99e-67	203	147	0.492	0.646	UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc4 PE=1 SV=1
17	P25867	7.08e-67	203	147	0.487	0.639	UBCD1_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster OX=7227 GN=eff PE=1 SV=1
18	Q9Y2X8	2.66e-66	202	147	0.477	0.626	UB2D4_HUMAN Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens OX=9606 GN=UBE2D4 PE=1 SV=1
19	P62837	2.90e-66	201	147	0.487	0.639	UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens OX=9606 GN=UBE2D2 PE=1 SV=1
20	P62838	2.90e-66	201	147	0.487	0.639	UB2D2_MOUSE Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus OX=10090 GN=Ube2d2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05773 RWD	10	17.8	RWD domain
2	PF10500 SR-25	1.9e+02	13.0	Nuclear RNA-splicing-associated protein
3	PF00179 UQ_con	2e-43	158.8	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008579358.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008587126.1	0.985	E3 ubiquitin-protein ligase TRIM21
2	482537.XP_008580937.1	0.921	E3 ubiquitin-protein ligase TRIP12 isoform X1
3	482537.XP_008591719.1	0.914	Ubiquitin-conjugating enzyme E2 U
4	482537.XP_008573219.1	0.909	Ubiquitin-like modifier-activating enzyme 1 isoform X1
5	482537.XP_008579124.1	0.909	Ubiquitin-conjugating enzyme E2 E3
6	482537.XP_008591407.1	0.909	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
7	482537.XP_008579375.1	0.908	Ubiquitin-conjugating enzyme E2 E2
8	482537.XP_008582398.1	0.865	E3 ubiquitin-protein ligase NEDD4 isoform X1
9	482537.XP_008574519.1	0.840	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
10	482537.XP_008570143.1	0.839	Breast cancer type 1 susceptibility protein
11	482537.XP_008569771.1	0.830	Ubiquitin-like modifier-activating enzyme 7
12	482537.XP_008565988.1	0.823	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
13	482537.XP_008566928.1	0.821	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 6 Proteins, and 61% coverage of the annotated genomic feature by RNAseq alignments
14	482537.XP_008588396.1	0.820	E3 ubiquitin-protein ligase TRIM32
15	482537.XP_008564149.1	0.816	Ubiquitin-conjugating enzyme E2 K
16	482537.XP_008577062.1	0.815	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 30 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
17	482537.XP_008565130.1	0.813	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 5 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
18	482537.XP_008585571.1	0.813	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 16 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
19	482537.XP_008570070.1	0.795	Ubiquitin-conjugating enzyme E2 variant 1 isoform X1
20	482537.XP_008588846.1	0.789	ubiquitin-60S ribosomal protein L40

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061631	0.999	ubiquitin conjugating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036211	0.995	protein modification process
GO:0016567	0.985	protein ubiquitination
GO:0009987	0.965	cellular process
GO:0044237	0.707	cellular metabolic process
GO:0030163	0.642	protein catabolic process
GO:0006508	0.633	proteolysis
GO:0044265	0.610	cellular macromolecule catabolic process
GO:0043632	0.556	modification-dependent macromolecule catabolic process
GO:0019941	0.554	modification-dependent protein catabolic process
GO:0000209	0.533	protein polyubiquitination
GO:0006511	0.529	ubiquitin-dependent protein catabolic process
GO:0050789	0.442	regulation of biological process
GO:0050794	0.398	regulation of cellular process
GO:0050896	0.306	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.998	nucleoplasm
GO:0032991	0.977	protein-containing complex
GO:1902494	0.932	catalytic complex
GO:0140535	0.821	intracellular protein-containing complex
GO:1990234	0.801	transferase complex
GO:0000151	0.577	ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.2.23	0.999	E2 ubiquitin-conjugating enzyme.

[back to server]