StarFunc result for job id P51991

User Input

>input (378 residues)
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGT
LTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPG
AHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTV
DKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRG
GNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQG
GGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPY
GGGYGSGGGSGGYGSRRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6URK4	0.595	0.593	1.248E-61	379	1.000	0.997	Q6URK4.pdb.gz	ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus OX=10116 GN=Hnrnpa3 PE=1 SV=1
2	AFDB:A0A024RAZ7	0.514	0.522	4.185E-46	372	0.741	0.753	A0A024RAZ7.pdb.gz
3	AFDB:A0A024RB53	0.510	0.601	5.822E-43	320	0.664	0.784	A0A024RB53.pdb.gz	A0A024RB53_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:E7FAQ8	0.523	0.511	1.808E-42	388	0.680	0.662	E7FAQ8.pdb.gz
5	AFDB:F8VZ49	0.505	0.819	1.292E-38	231	0.474	0.775	F8VZ49.pdb.gz	F8VZ49_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1
6	AFDB:A0A087WUI2	0.488	0.704	7.641E-35	261	0.381	0.552	A0A087WUI2.pdb.gz	A0A087WUI2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=1
7	AFDB:B5X0T7	0.482	0.602	5.726E-34	300	0.497	0.627	B5X0T7.pdb.gz	B5X0T7_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
8	AFDB:P48810	0.492	0.484	2.016E-33	385	0.495	0.486	P48810.pdb.gz	RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster OX=7227 GN=Hrb87F PE=2 SV=2
9	AFDB:F1QS28	0.488	0.600	6.842E-32	305	0.476	0.590	F1QS28.pdb.gz	F1QS28_DANRE Heterogeneous nuclear ribonucleoprotein A0 OS=Danio rerio OX=7955 GN=fc01g05 PE=1 SV=1
10	AFDB:B5X3U2	0.477	0.640	1.206E-31	279	0.460	0.624	B5X3U2.pdb.gz	B5X3U2_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
11	PDB:6y53o	0.193	0.440	1.192E-11	160	0.106	0.250	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
12	PDB:7oqcF	0.197	0.268	1.738E-11	267	0.108	0.154	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:6r5kH	0.213	0.205	7.125E-10	394	0.130	0.124	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
14	PDB:5vsuA	0.226	0.221	2.356E-9	387	0.079	0.078	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
15	PDB:7evoD	0.174	0.322	6.868E-9	200	0.098	0.185	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:6y5qq	0.167	0.343	1.136E-8	178	0.087	0.185	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
17	PDB:5lsbA	0.191	0.398	4.261E-8	176	0.071	0.153	5lsbA.pdb.gz
18	PDB:5yzg1	0.199	0.307	9.068E-8	243	0.103	0.160	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:6g90B	0.190	0.358	3.621E-7	193	0.069	0.135	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
20	PDB:6n7pA	0.196	0.389	3.856E-7	186	0.066	0.134	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384NL63	0.0	728	378	1.000	1.000	A0A384NL63_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=HNRPA3 PE=2 SV=1
2	B4DDB6	0.0	681	356	0.939	0.997	B4DDB6_HUMAN Heterogeneous nuclear ribonucleoprotein A3, isoform CRA_a OS=Homo sapiens OX=9606 GN=HNRPA3 PE=2 SV=1
3	P51991	0.0	728	378	1.000	1.000	ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2
4	Q6URK4	0.0	724	379	1.000	0.997	ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus OX=10116 GN=Hnrnpa3 PE=1 SV=1
5	F8W6I7	2.34e-132	383	307	0.571	0.704	F8W6I7_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=2
6	Q0VAC0	1.05e-122	358	320	0.574	0.678	Q0VAC0_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRPA1 PE=2 SV=1
7	A0A024RB53	1.19e-122	358	320	0.574	0.678	A0A024RB53_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
8	P49312	1.19e-122	358	320	0.574	0.678	ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus OX=10090 GN=Hnrnpa1 PE=1 SV=2
9	P04256	9.44e-122	356	320	0.571	0.675	ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus OX=10116 GN=Hnrnpa1 PE=1 SV=3
10	P09651	8.98e-119	350	372	0.429	0.435	ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5
11	F8VZ49	3.84e-115	336	231	0.444	0.727	F8VZ49_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1
12	I6L957	2.01e-105	312	249	0.378	0.574	I6L957_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=1
13	A0A087WUI2	4.80e-105	311	261	0.378	0.548	A0A087WUI2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=1
14	Q7SXQ3	3.90e-103	311	388	0.376	0.366	Q7SXQ3_DANRE Heterogeneous nuclear ribonucleoprotein A1 OS=Danio rerio OX=7955 GN=hnrnpa1a PE=1 SV=1
15	A0A2R8Y4L2	1.07e-89	273	275	0.484	0.665	RA1L3_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 3 OS=Homo sapiens OX=9606 GN=HNRNPA1L3 PE=4 SV=1
16	P48810	5.30e-75	239	385	0.283	0.278	RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster OX=7227 GN=Hrb87F PE=2 SV=2
17	B5X3U2	8.55e-75	235	279	0.294	0.398	B5X3U2_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
18	P07909	6.91e-74	236	365	0.286	0.296	ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster OX=7227 GN=Hrb98DE PE=2 SV=1
19	Q22037	1.53e-68	221	346	0.267	0.292	ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans OX=6239 GN=hrp-1 PE=1 SV=1
20	B5X3S8	8.93e-67	215	299	0.423	0.535	B5X3S8_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14605 Nup35_RRM_2	4	18.8	Nup53/35/40-type RNA recognition motif
2	PF14703 PHM7_cyt	5.9e+02	12.1	Cytosolic domain of 10TM putative phosphate transporter
3	PF00076 RRM_1	4.3e-31	117.9	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	7.8e-08	43.7	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 43179.ENSSTOP00000022160

Rank	PPI partner	STRING score	Description
1	43179.ENSSTOP00000012644	0.829	Heterogeneous nuclear ribonucleoprotein K
2	43179.ENSSTOP00000007277	0.824	Heterogeneous nuclear ribonucleoprotein M
3	43179.ENSSTOP00000000138	0.788	Heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
4	43179.ENSSTOP00000000213	0.768	Serine/arginine-rich splicing factor 1
5	43179.ENSSTOP00000009981	0.768	RNA binding motif protein 25
6	43179.ENSSTOP00000019776	0.733	Heterogeneous nuclear ribonucleoprotein H2 (H')
7	43179.ENSSTOP00000016548	0.731	Heterogeneous nuclear ribonucleoprotein R
8	43179.ENSSTOP00000005035	0.711	Heterogeneous nuclear ribonucleoprotein L
9	43179.ENSSTOP00000012515	0.709	Heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
10	43179.ENSSTOP00000014831	0.706	Aly/REF export factor
11	43179.ENSSTOP00000000102	0.696	Y box binding protein 1
12	43179.ENSSTOP00000006011	0.696	Transformer 2 beta homolog (Drosophila)
13	43179.ENSSTOP00000014665	0.688	Heterogeneous nuclear ribonucleoprotein H1 (H)
14	43179.ENSSTOP00000001431	0.680	pre-mRNA processing factor 19
15	43179.ENSSTOP00000005557	0.678	RNA binding motif protein, X-linked-like 1
16	43179.ENSSTOP00000017205	0.671	Uncharacterized protein
17	43179.ENSSTOP00000023370	0.671	annotation not available
18	43179.ENSSTOP00000009939	0.663	Staufen double-stranded RNA binding protein 2
19	43179.ENSSTOP00000021331	0.660	Small nuclear ribonucleoprotein D3 polypeptide 18kDa
20	43179.ENSSTOP00000001019	0.657	PRP40 pre-mRNA processing factor 40 homolog B (S. cerevisiae)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003729	0.997	mRNA binding
GO:0005515	0.984	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0010467	0.978	gene expression
GO:1901360	0.967	organic cyclic compound metabolic process
GO:0046483	0.967	heterocycle metabolic process
GO:0006725	0.966	cellular aromatic compound metabolic process
GO:0016070	0.963	RNA metabolic process
GO:0000398	0.946	mRNA splicing, via spliceosome
GO:0050789	0.853	regulation of biological process
GO:0019222	0.699	regulation of metabolic process
GO:0050794	0.686	regulation of cellular process
GO:0060255	0.654	regulation of macromolecule metabolic process
GO:0051179	0.594	localization
GO:0080090	0.567	regulation of primary metabolic process
GO:0051171	0.567	regulation of nitrogen compound metabolic process
GO:0031323	0.511	regulation of cellular metabolic process
GO:0006403	0.494	RNA localization
GO:0015931	0.447	nucleobase-containing compound transport
GO:0010468	0.441	regulation of gene expression
GO:0019219	0.401	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.396	negative regulation of biological process
GO:0051252	0.390	regulation of RNA metabolic process
GO:0048518	0.381	positive regulation of biological process
GO:0048523	0.324	negative regulation of cellular process
GO:0048522	0.317	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.931	protein-containing complex
GO:0005737	0.743	cytoplasm
GO:0140513	0.519	nuclear protein-containing complex
GO:0005829	0.518	cytosol
GO:1990904	0.380	ribonucleoprotein complex
GO:0005681	0.326	spliceosomal complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]