StarFunc result for job id P51993

User Input

>input (359 residues)
MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHS
IPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQL
PRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAH
PPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRY
KFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKD
LARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51993	1.000	1.000	3.421E-81	359	1.000	1.000	P51993.pdb.gz	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
2	AFDB:Q11128	0.847	0.813	1.164E-70	374	0.891	0.856	Q11128.pdb.gz	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
3	AFDB:P22083	0.771	0.529	6.078E-41	530	0.437	0.296	P22083.pdb.gz	FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens OX=9606 GN=FUT4 PE=1 SV=3
4	AFDB:Q11127	0.781	0.652	5.893E-39	433	0.412	0.342	Q11127.pdb.gz	FUT4_MOUSE Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1
5	AFDB:Q712G6	0.766	0.743	2.197E-38	370	0.437	0.424	Q712G6.pdb.gz	FUT7_RAT Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegicus OX=10116 GN=Fut7 PE=1 SV=1
6	AFDB:O88819	0.794	0.794	3.407E-38	359	0.387	0.387	O88819.pdb.gz	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
7	AFDB:Q62994	0.782	0.652	3.627E-38	433	0.412	0.342	Q62994.pdb.gz	FUT4_RAT Alpha-(1,3)-fucosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=Fut4 PE=2 SV=1
8	AFDB:Q11131	0.781	0.722	4.962E-38	389	0.421	0.388	Q11131.pdb.gz	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
9	AFDB:Q11130	0.771	0.808	7.694E-38	342	0.426	0.447	Q11130.pdb.gz	FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 OS=Homo sapiens OX=9606 GN=FUT7 PE=1 SV=1
10	AFDB:G3MZR2	0.771	0.809	3.054E-37	342	0.423	0.444	G3MZR2.pdb.gz	FUT7_BOVIN Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
11	PDB:7au2A	0.349	0.215	2.212E-4	686	0.150	0.079	7au2A.pdb.gz
12	PDB:1ya6A	0.360	0.344	9.953E-4	380	0.106	0.100	1ya6A.pdb.gz	Structural evidence of a passive base-flipping mechanism for AGT, an unusual GT-B glycosyltransferase.
13	PDB:3okaA	0.303	0.291	1.543E-3	378	0.109	0.103	3okaA.pdb.gz	Acceptor substrate discrimination in phosphatidyl-myo-inositol mannoside synthesis: structural and mutational analysis of mannosyltransferase Corynebacterium glutamicum PimB'.
14	PDB:1xv5A	0.375	0.342	1.862E-3	401	0.111	0.100	1xv5A.pdb.gz	Structural evidence of a passive base-flipping mechanism for AGT, an unusual GT-B glycosyltransferase.
15	PDB:4nc9A	0.329	0.322	5.076E-3	369	0.114	0.111	4nc9A.pdb.gz
16	PDB:5f84A	0.281	0.277	7.871E-3	365	0.061	0.060	5f84A.pdb.gz	Structural analysis of Notch-regulating Rumi reveals basis for pathogenic mutations.
17	PDB:7jlxA	0.170	0.319	9.498E-3	166	0.072	0.157	7jlxA.pdb.gz
18	PDB:4njmA	0.172	0.193	1.473E-2	303	0.111	0.132	4njmA.pdb.gz	Crystal structures and kinetics of Type III 3-phosphoglycerate dehydrogenase reveal catalysis by lysine.
19	PDB:1f6dA	0.342	0.330	1.568E-2	376	0.081	0.077	1f6dA.pdb.gz	The structure of UDP-N-acetylglucosamine 2-epimerase reveals homology to phosphoglycosyl transferases.
20	PDB:1z16A	0.203	0.209	1.669E-2	344	0.114	0.119	1z16A.pdb.gz	Ligand-free and -bound structures of the binding protein (LivJ) of the Escherichia coli ABC leucine/isoleucine/valine transport system: trajectory and dynamics of the interdomain rotation and ligand specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21217	0.0	615	361	0.852	0.848	FUT3_HUMAN 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 OS=Homo sapiens OX=9606 GN=FUT3 PE=1 SV=1
2	P51993	0.0	746	359	1.000	1.000	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
3	Q11128	0.0	644	374	0.891	0.856	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
4	Q6P7E6	0.0	740	359	0.992	0.992	Q6P7E6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
5	Q9P1W6	0.0	613	361	0.850	0.845	Q9P1W6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT3 PE=2 SV=1
6	Q11131	1.90e-82	258	389	0.412	0.380	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
7	Q11130	6.65e-82	254	342	0.404	0.424	FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 OS=Homo sapiens OX=9606 GN=FUT7 PE=1 SV=1
8	Q712G6	1.04e-81	255	370	0.440	0.427	FUT7_RAT Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegicus OX=10116 GN=Fut7 PE=1 SV=1
9	G3MZR2	2.28e-81	253	342	0.401	0.421	FUT7_BOVIN Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
10	O88819	7.46e-81	253	359	0.373	0.373	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
11	Q9Y231	2.73e-80	251	359	0.370	0.370	FUT9_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Homo sapiens OX=9606 GN=FUT9 PE=1 SV=2
12	Q99JB3	3.61e-80	251	359	0.365	0.365	FUT9_RAT 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Rattus norvegicus OX=10116 GN=Fut9 PE=1 SV=1
13	P22083	7.26e-74	239	530	0.418	0.283	FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens OX=9606 GN=FUT4 PE=1 SV=3
14	Q11127	1.32e-72	234	433	0.401	0.333	FUT4_MOUSE Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1
15	Q62994	1.33e-68	223	433	0.404	0.335	FUT4_RAT Alpha-(1,3)-fucosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=Fut4 PE=2 SV=1
16	E9PS22	2.75e-43	146	69	0.192	1.000	E9PS22_HUMAN Fucosyltransferase 6 (Fragment) OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
17	E9PP56	8.68e-41	139	66	0.184	1.000	E9PP56_HUMAN Fucosyltransferase 6 (Fragment) OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
18	Q9VUL9	2.22e-39	147	503	0.273	0.195	FUCTA_DROME Glycoprotein 3-alpha-L-fucosyltransferase A OS=Drosophila melanogaster OX=7227 GN=FucTA PE=1 SV=2
19	G5EE06	2.28e-36	137	378	0.256	0.243	FUTD_CAEEL Alpha-(1,3)-fucosyltransferase fut-5 OS=Caenorhabditis elegans OX=6239 GN=fut-5 PE=1 SV=1
20	G5EDR5	3.34e-35	135	433	0.228	0.189	FUTA_CAEEL Alpha-(1,3)-fucosyltransferase fut-1 OS=Caenorhabditis elegans OX=6239 GN=fut-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00852 Glyco_transf_10	1e-63	225.8	Glycosyltransferase family 10 (fucosyltransferase) C-term
2	PF17039 Glyco_tran_10_N	2.7e-33	126.1	Fucosyltransferase, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312021	0.976	Galactoside 2-alpha-L-fucosyltransferase 1
2	9606.ENSP00000369055	0.975	Beta-1,4-galactosyltransferase 1
3	9606.ENSP00000387498	0.974	Galactoside 2-alpha-L-fucosyltransferase 2
4	9606.ENSP00000436047	0.963	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
5	9606.ENSP00000262915	0.960	ST3 beta-galactoside alpha-2,3-sialyltransferase 3
6	9606.ENSP00000321874	0.943	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
7	9606.ENSP00000480884	0.943	Type 2 lactosamine alpha-2,3-sialyltransferase
8	9606.ENSP00000310696	0.932	Beta-1,4-galactosyltransferase 2
9	9606.ENSP00000480428	0.925	Beta-1,4-galactosyltransferase 3
10	9606.ENSP00000319636	0.923	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4
11	9606.ENSP00000368917	0.921	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
12	9606.ENSP00000420161	0.917	Beta-1,4-galactosyltransferase 4
13	9606.ENSP00000305595	0.916	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
14	9606.ENSP00000483018	0.913	Histo-blood group ABO system transferase
15	9606.ENSP00000379353	0.912	Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
16	9606.ENSP00000302599	0.909	Alpha-(1,3)-fucosyltransferase 9
17	9606.ENSP00000351602	0.909	Alpha-(1,3)-fucosyltransferase 4
18	9606.ENSP00000268164	0.907	Alpha-2,8-sialyltransferase 8B
19	9606.ENSP00000309270	0.902	Carbohydrate sulfotransferase 1
20	9606.ENSP00000353910	0.829	Alpha-(1,6)-fucosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046920	1.000	alpha-(1->3)-fucosyltransferase activity
GO:0017083	0.898	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity
GO:0005488	0.890	binding
GO:0005515	0.771	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901135	0.995	carbohydrate derivative metabolic process
GO:0044249	0.995	cellular biosynthetic process
GO:1901566	0.995	organonitrogen compound biosynthetic process
GO:0006486	0.988	protein glycosylation
GO:0006643	0.981	membrane lipid metabolic process
GO:0005975	0.958	carbohydrate metabolic process
GO:0009312	0.951	oligosaccharide biosynthetic process
GO:0006665	0.937	sphingolipid metabolic process
GO:0006672	0.923	ceramide metabolic process
GO:0006493	0.922	protein O-linked glycosylation
GO:0006487	0.869	protein N-linked glycosylation
GO:0006664	0.501	glycolipid metabolic process
GO:0009247	0.355	glycolipid biosynthetic process
GO:0006687	0.353	glycosphingolipid metabolic process
GO:0050789	0.326	regulation of biological process
GO:0030148	0.317	sphingolipid biosynthetic process
GO:0006688	0.314	glycosphingolipid biosynthetic process
GO:0050794	0.302	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0098588	0.996	bounding membrane of organelle
GO:0000139	0.990	Golgi membrane
GO:0005576	0.981	extracellular region
GO:0005615	0.914	extracellular space
GO:0070062	0.888	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:14257	0.898	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = a beta-D-galactosyl-(1->4)-[alpha-L-fucosyl-(1->3)]-N-acetyl-beta-D-glucosaminyl derivative + GDP + H(+)
EC:2.4.1.152	0.898	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase.

[back to server]