StarFunc result for job id P52179

User Input

>input (1685 residues)
MSLPFYQRCHQHYDLSYRNKDVRSTVSHYQREKKRSAVYTQGSTAYSSRSSAAHRRESEA
FRRASASSSQQQASQHALSSEVSRKAASAYDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK
HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT
SKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKS
RKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSI
AGWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINGCDFEDTAQYRASAMNVKGE
LSAYASVVVKRYKGEFDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGE
TMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLY
TIRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSP
ILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSE
PVAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKP
PGQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGV
GEPSEATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESKDAKELVGYYIEASVAGS
GKWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVS
PDVCPALSDEPGGLTASRGRVHEASPPTFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVS
ETVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPCDITCLESFRDSMVLGWKQPDKI
GGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLG
APSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEA
KAKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPG
TKEVVVNVDDDGVISLNFECDKMTPKSEFSWSKDYVSTEDSPRLEVESKGNKTKMTFKDL
GMDDLGIYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQV
RFWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQL
QDGKATNHSTVVLVGDVFKKLQKEAEFQRQEWIRKQGPHFVEYLSWEVTGECNVLLKCKV
ANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSR
LKLVDEAFKELMMEVCKKIALSATDLKIQSTAEGIQLYSFVTYYVEDLKVNWSHNGSAIR
YSDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYDEAYAEFQR
LKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCN
LKFEAGRTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALESLKG
GKKAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52179	1.000	1.000	0.000	1685	1.000	1.000	P52179.pdb.gz	MYOM1_HUMAN Myomesin-1 OS=Homo sapiens OX=9606 GN=MYOM1 PE=1 SV=2
2	AFDB:P54296	0.214	0.240	0.000	1465	0.395	0.454	P54296.pdb.gz	MYOM2_HUMAN Myomesin-2 OS=Homo sapiens OX=9606 GN=MYOM2 PE=1 SV=3
3	AFDB:Q9VPZ7	0.085	0.096	1.342E-32	1342	0.109	0.136	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
4	AFDB:Q96MS0	0.077	0.089	1.615E-32	1386	0.096	0.116	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
5	AFDB:P40189	0.090	0.150	9.289E-26	918	0.066	0.121	P40189.pdb.gz	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
6	AFDB:P13595	0.076	0.105	8.931E-25	1115	0.069	0.105	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
7	AFDB:Q05BQ1	0.073	0.095	1.234E-24	1179	0.099	0.141	Q05BQ1.pdb.gz	TUTLA_MOUSE Protein turtle homolog A OS=Mus musculus OX=10090 GN=Igsf9 PE=1 SV=2
8	AFDB:Q9VBE5	0.073	0.088	1.999E-21	1298	0.060	0.078	Q9VBE5.pdb.gz	Q9VBE5_DROME MIP08606p OS=Drosophila melanogaster OX=7227 GN=plum PE=2 SV=2
9	AFDB:Q8WZ75	0.059	0.095	5.068E-20	1007	0.089	0.149	Q8WZ75.pdb.gz	ROBO4_HUMAN Roundabout homolog 4 OS=Homo sapiens OX=9606 GN=ROBO4 PE=1 SV=1
10	PDB:1e07A	0.062	0.138	2.274E-18	642	0.065	0.170	1e07A.pdb.gz
11	PDB:5oj2B	0.068	0.133	9.088E-18	692	0.067	0.163	5oj2B.pdb.gz
12	AFDB:E9Q4Y4	0.086	0.063	1.303E-16	2514	0.077	0.051	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
13	PDB:7q5zA	0.077	0.089	1.333E-15	1344	0.065	0.082	7q5zA.pdb.gz
14	PDB:7q1yA	0.082	0.091	1.854E-14	1374	0.058	0.071	7q1yA.pdb.gz
15	PDB:7vonA	0.087	0.098	1.240E-12	1399	0.052	0.063	7vonA.pdb.gz
16	PDB:5a42A	0.066	0.068	3.124E-12	1597	0.062	0.066	5a42A.pdb.gz
17	PDB:7nycA	0.089	0.093	5.193E-12	1542	0.053	0.058	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:6h03A	0.081	0.096	9.466E-12	1223	0.056	0.077	6h03A.pdb.gz
19	PDB:7sqcO0	0.056	0.071	1.435E-11	1140	0.064	0.094	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:6pxvA	0.054	0.109	3.784E-11	823	0.035	0.072	6pxvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K5P5	0.0	2955	1676	0.864	0.868	A0A0G2K5P5_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=2
2	A0A8I6AC90	0.0	690	1541	0.278	0.304	A0A8I6AC90_RAT Myomesin 2 OS=Rattus norvegicus OX=10116 GN=Myom2 PE=1 SV=1
3	A0A8I6GBP8	0.0	3018	1689	0.878	0.876	A0A8I6GBP8_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=1
4	A0A8I6GFM8	0.0	1525	1592	0.462	0.489	A0A8I6GFM8_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=1
5	A2ABU4	0.0	736	1439	0.251	0.294	MYOM3_MOUSE Myomesin-3 OS=Mus musculus OX=10090 GN=Myom3 PE=1 SV=1
6	E1BF23	0.0	700	1495	0.293	0.330	E1BF23_BOVIN Myomesin 2 OS=Bos taurus OX=9913 GN=MYOM2 PE=4 SV=3
7	F1N9Z6	0.0	1210	1587	0.341	0.362	F1N9Z6_CHICK Myomesin 1 OS=Gallus gallus OX=9031 GN=MYOM1 PE=4 SV=4
8	G3V7K1	0.0	686	1472	0.280	0.321	G3V7K1_RAT Myomesin 2 OS=Rattus norvegicus OX=10116 GN=Myom2 PE=1 SV=2
9	O55124	0.0	676	1463	0.272	0.314	O55124_MOUSE M-protein OS=Mus musculus OX=10090 GN=Myom2 PE=2 SV=1
10	P52179	0.0	3497	1685	1.000	1.000	MYOM1_HUMAN Myomesin-1 OS=Homo sapiens OX=9606 GN=MYOM1 PE=1 SV=2
11	P54296	0.0	673	1465	0.272	0.313	MYOM2_HUMAN Myomesin-2 OS=Homo sapiens OX=9606 GN=MYOM2 PE=1 SV=3
12	Q14BI5	0.0	687	1463	0.275	0.316	Q14BI5_MOUSE Myomesin 2 OS=Mus musculus OX=10090 GN=Myom2 PE=1 SV=1
13	Q3UQS9	0.0	683	1463	0.274	0.316	Q3UQS9_MOUSE Myomesin-2 OS=Mus musculus OX=10090 GN=Myom2 PE=2 SV=1
14	Q5VTT5	0.0	733	1437	0.254	0.298	MYOM3_HUMAN Myomesin-3 OS=Homo sapiens OX=9606 GN=MYOM3 PE=1 SV=1
15	Q62234	0.0	2965	1667	0.862	0.872	MYOM1_MOUSE Myomesin-1 OS=Mus musculus OX=10090 GN=Myom1 PE=1 SV=2
16	P80473	5.41e-73	249	340	0.113	0.562	MYOM1_BOVIN Myomesin-1 (Fragments) OS=Bos taurus OX=9913 GN=MYOM1 PE=1 SV=1
17	A0A8I5ZU83	9.73e-66	251	26931	0.144	0.009	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
18	A0A8I5ZUN3	3.06e-65	249	35375	0.144	0.007	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
19	Q8WZ42	9.47e-64	244	34350	0.140	0.007	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
20	A2ASS6	2.25e-63	243	35213	0.132	0.006	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	4.6e-07	41.1	CD80-like C2-set immunoglobulin domain
2	PF00041 fn3	1.4e-76	264.2	Fibronectin type III domain
3	PF07679 I-set	3.7e-73	253.0	Immunoglobulin I-set domain
4	PF00047 ig	2.4e-19	80.6	Immunoglobulin domain
5	PF13895 Ig_2	1.2e-31	120.2	Immunoglobulin domain
6	PF13927 Ig_3	1.1e-44	162.2	Immunoglobulin domain
7	PF09294 Interfer-bind	60	15.4	Interferon-alpha/beta receptor, fibronectin type III
8	PF16706 Izumo-Ig	1.9e+02	13.4	Izumo-like Immunoglobulin domain
9	PF01108 Tissue_fac	4.8e-05	34.5	Tissue factor
10	PF07686 V-set	2.6e-15	67.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348821

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000452786	0.713	Integrin beta-3
2	9606.ENSP00000379210	0.611	Myosin light chain 3
3	9606.ENSP00000347507	0.586	Myosin-7
4	9606.ENSP00000255006	0.567	Ras and Rab interactor 2
5	9606.ENSP00000480740	0.565	Leucine-rich repeat-containing protein 39
6	9606.ENSP00000463559	0.545	Myosin regulatory light chain 12B
7	9606.ENSP00000443495	0.531	Alpha-actinin-2
8	9606.ENSP00000467141	0.526	Titin
9	9606.ENSP00000362935	0.521	Integrin beta-1-binding protein 2
10	9606.ENSP00000400113	0.520	Palmitoyltransferase ZDHHC13
11	9606.ENSP00000441726	0.517	Clusterin-like protein 1
12	9606.ENSP00000386041	0.512	Myosin-6
13	9606.ENSP00000217652	0.501	Myosin regulatory light chain 12A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0008307	0.999	structural constituent of muscle
GO:0019899	0.995	enzyme binding
GO:0019900	0.939	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.987	multicellular organismal process
GO:0048856	0.913	anatomical structure development
GO:0050789	0.898	regulation of biological process
GO:0009987	0.879	cellular process
GO:0048513	0.824	animal organ development
GO:0007275	0.736	multicellular organism development
GO:0061061	0.733	muscle structure development
GO:0050794	0.713	regulation of cellular process
GO:0048731	0.691	system development
GO:0060537	0.549	muscle tissue development
GO:0003012	0.477	muscle system process
GO:0006936	0.471	muscle contraction
GO:0048518	0.460	positive regulation of biological process
GO:0050896	0.456	response to stimulus
GO:0007517	0.445	muscle organ development
GO:0048522	0.317	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030017	1.000	sarcomere
GO:0005856	0.705	cytoskeleton
GO:0043227	0.666	membrane-bounded organelle
GO:0031672	0.463	A band
GO:0005829	0.446	cytosol
GO:0036379	0.444	myofilament
GO:0032982	0.348	myosin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]