StarFunc result for job id P52209

User Input

>input (483 residues)
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSS
YNA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00349	0.999	0.999	1.243E-79	483	0.944	0.944	P00349.pdb.gz	6PGD_SHEEP 6-phosphogluconate dehydrogenase, decarboxylating OS=Ovis aries OX=9940 GN=PGD PE=1 SV=4
2	AFDB:A0A060WX43	0.998	0.998	1.083E-76	483	0.870	0.870	A0A060WX43.pdb.gz	A0A060WX43_ONCMY 6-phosphogluconate dehydrogenase, decarboxylating OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00001777001 PE=3 SV=1
3	PDB:2jkvA	0.981	0.983	4.011E-75	482	0.998	1.000	2jkvA.pdb.gz	Structure of Human Phosphogluconate Dehydrogenase in Complex with Nadph at 2.53A
4	AFDB:P41572	0.987	0.991	6.502E-68	481	0.716	0.719	P41572.pdb.gz	6PGD_DROME 6-phosphogluconate dehydrogenase, decarboxylating OS=Drosophila melanogaster OX=7227 GN=Pgd PE=2 SV=1
5	AFDB:Q17761	0.991	0.989	6.735E-67	484	0.698	0.696	Q17761.pdb.gz	6PGD_CAEEL 6-phosphogluconate dehydrogenase, decarboxylating OS=Caenorhabditis elegans OX=6239 GN=T25B9.9 PE=3 SV=2
6	AFDB:P78812	0.987	0.969	4.663E-65	492	0.675	0.663	P78812.pdb.gz	6PGD_SCHPO 6-phosphogluconate dehydrogenase, decarboxylating OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC660.16 PE=1 SV=2
7	AFDB:G8BFS5	0.984	0.947	5.948E-65	502	0.667	0.641	G8BFS5.pdb.gz	G8BFS5_CANPC 6-phosphogluconate dehydrogenase, decarboxylating OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=GND1 PE=3 SV=1
8	AFDB:P53319	0.986	0.968	9.681E-65	492	0.652	0.640	P53319.pdb.gz	6PGD2_YEAST 6-phosphogluconate dehydrogenase, decarboxylating 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GND2 PE=1 SV=1
9	AFDB:P38720	0.977	0.965	1.176E-64	489	0.660	0.652	P38720.pdb.gz	6PGD1_YEAST 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GND1 PE=1 SV=1
10	AFDB:A0A1D8PFS4	0.986	0.962	3.116E-64	495	0.660	0.644	A0A1D8PFS4.pdb.gz	A0A1D8PFS4_CANAL 6-phosphogluconate dehydrogenase, decarboxylating OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GND1 PE=3 SV=1
11	AFDB:Q6FIM1	0.983	0.971	4.173E-64	489	0.652	0.644	Q6FIM1.pdb.gz	Q6FIM1_CANGA 6-phosphogluconate dehydrogenase, decarboxylating OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GND1 PE=3 SV=1
12	PDB:2p4qA	0.958	0.971	7.989E-61	476	0.640	0.649	2p4qA.pdb.gz	Crystal structure of Saccharomyces cerevisiae 6-phosphogluconate dehydrogenase Gnd1
13	PDB:3fwnA	0.952	0.984	3.810E-53	467	0.522	0.540	3fwnA.pdb.gz	Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
14	PDB:1pgjA	0.917	0.927	2.110E-38	478	0.335	0.339	1pgjA.pdb.gz
15	PDB:3ckyA	0.391	0.599	6.981E-11	297	0.124	0.202	3ckyA.pdb.gz
16	PDB:3dojA	0.383	0.607	1.501E-9	292	0.110	0.182	3dojA.pdb.gz
17	PDB:3obbA	0.447	0.693	3.788E-9	295	0.120	0.197	3obbA.pdb.gz	Biochemical and Structural Studies of Uncharacterized Protein PA0743 from Pseudomonas aeruginosa Revealed NAD+-dependent L-Serine Dehydrogenase.
18	PDB:6smzC	0.380	0.598	8.670E-9	295	0.133	0.217	6smzC.pdb.gz	Dynamic Structural Changes Accompany the Production of Dihydroxypropanesulfonate by Sulfolactaldehyde Reductase
19	PDB:3ulkA	0.318	0.314	2.852E-6	489	0.116	0.115	3ulkA.pdb.gz	Bacterial and plant ketol-acid reductoisomerases have different mechanisms of induced fit during the catalytic cycle
20	PDB:2f1kA	0.320	0.515	8.743E-6	279	0.091	0.158	2f1kA.pdb.gz	Biochemical Characterization and Crystal Structure of Synechocystis Arogenate Dehydrogenase Provide Insights into Catalytic Reaction

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060WX43	0.0	872	483	0.870	0.870	A0A060WX43_ONCMY 6-phosphogluconate dehydrogenase, decarboxylating OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00001777001 PE=3 SV=1
2	A0A1D8PFS4	0.0	631	495	0.665	0.648	A0A1D8PFS4_CANAL 6-phosphogluconate dehydrogenase, decarboxylating OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GND1 PE=3 SV=1
3	G8BFS5	0.0	655	502	0.669	0.643	G8BFS5_CANPC 6-phosphogluconate dehydrogenase, decarboxylating OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=GND1 PE=3 SV=1
4	P00349	0.0	907	483	0.944	0.944	6PGD_SHEEP 6-phosphogluconate dehydrogenase, decarboxylating OS=Ovis aries OX=9940 GN=PGD PE=1 SV=4
5	P00350	0.0	523	468	0.526	0.543	6PGD_ECOLI 6-phosphogluconate dehydrogenase, decarboxylating OS=Escherichia coli (strain K12) OX=83333 GN=gnd PE=1 SV=2
6	P38720	0.0	639	489	0.663	0.654	6PGD1_YEAST 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GND1 PE=1 SV=1
7	P41572	0.0	697	481	0.718	0.721	6PGD_DROME 6-phosphogluconate dehydrogenase, decarboxylating OS=Drosophila melanogaster OX=7227 GN=Pgd PE=2 SV=1
8	P52209	0.0	1001	483	1.000	1.000	6PGD_HUMAN 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD PE=1 SV=3
9	P53319	0.0	651	492	0.652	0.640	6PGD2_YEAST 6-phosphogluconate dehydrogenase, decarboxylating 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GND2 PE=1 SV=1
10	P78812	0.0	649	492	0.671	0.659	6PGD_SCHPO 6-phosphogluconate dehydrogenase, decarboxylating OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC660.16 PE=1 SV=2
11	P85968	0.0	904	483	0.932	0.932	6PGD_RAT 6-phosphogluconate dehydrogenase, decarboxylating OS=Rattus norvegicus OX=10116 GN=Pgd PE=1 SV=1
12	Q17761	0.0	721	484	0.698	0.696	6PGD_CAEEL 6-phosphogluconate dehydrogenase, decarboxylating OS=Caenorhabditis elegans OX=6239 GN=T25B9.9 PE=3 SV=2
13	Q6FIM1	0.0	651	489	0.650	0.642	Q6FIM1_CANGA 6-phosphogluconate dehydrogenase, decarboxylating OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GND1 PE=3 SV=1
14	Q9DCD0	0.0	909	483	0.940	0.940	6PGD_MOUSE 6-phosphogluconate dehydrogenase, decarboxylating OS=Mus musculus OX=10090 GN=Pgd PE=1 SV=3
15	Q9LI00	1.17e-161	468	480	0.484	0.487	6PGD1_ORYSJ 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Oryza sativa subsp. japonica OX=39947 GN=G6PGH1 PE=2 SV=1
16	Q94KU2	7.01e-161	468	537	0.495	0.445	6PGD2_SPIOL 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Spinacia oleracea OX=3562 GN=pgdP PE=1 SV=1
17	Q9FWA3	8.85e-160	463	486	0.493	0.490	6PGD2_ARATH 6-phosphogluconate dehydrogenase, decarboxylating 2 OS=Arabidopsis thaliana OX=3702 GN=PGD2 PE=1 SV=1
18	Q9FFR3	1.18e-159	463	487	0.503	0.499	6PGD3_ARATH 6-phosphogluconate dehydrogenase, decarboxylating 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGD3 PE=1 SV=1
19	O51509	4.96e-158	458	464	0.462	0.481	O51509_BORBU 6-phosphogluconate dehydrogenase, decarboxylating OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=gnd PE=3 SV=1
20	Q2R480	7.23e-158	459	508	0.495	0.470	6PGD2_ORYSJ 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=G6PGH2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00393 6PGD	5.9e-128	437.9	6-phosphogluconate dehydrogenase, C-terminal domain
2	PF03807 F420_oxidored	5.6e+02	12.6	NADP oxidoreductase coenzyme F420-dependent
3	PF14833 NAD_binding_11	3.2e+02	12.9	NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
4	PF03446 NAD_binding_2	2e-45	166.3	NAD binding domain of 6-phosphogluconate dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270776

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000473348	0.999	GDH/6PGL endoplasmic bifunctional protein
2	9606.ENSP00000377192	0.998	Glucose-6-phosphate 1-dehydrogenase
3	9606.ENSP00000252603	0.997	6-phosphogluconolactonase
4	9606.ENSP00000321259	0.996	Transaldolase
5	9606.ENSP00000352401	0.994	Ribulose-phosphate 3-epimerase
6	9606.ENSP00000365601	0.994	IDNK, gluconokinase
7	9606.ENSP00000476672	0.987	Ribulose-phosphate 3-epimerase-like protein 1
8	9606.ENSP00000283646	0.984	Ribose 5-phosphate isomerase A
9	9606.ENSP00000391481	0.953	Transketolase
10	9606.ENSP00000405573	0.911	Glucose-6-phosphate isomerase
11	9606.ENSP00000362413	0.887	Phosphoglycerate kinase 1
12	9606.ENSP00000360124	0.855	Phosphoglucomutase-1
13	9606.ENSP00000367992	0.817	S-formylglutathione hydrolase
14	9606.ENSP00000358931	0.816	Transketolase-like protein 1
15	9606.ENSP00000305995	0.811	Phosphoglycerate kinase 2
16	9606.ENSP00000221130	0.805	Glutathione reductase, mitochondrial
17	9606.ENSP00000280605	0.803	Transketolase-like protein 2
18	9606.ENSP00000371393	0.798	Phosphoglucomutase-2
19	9606.ENSP00000229270	0.785	Triosephosphate isomerase 1
20	9606.ENSP00000390265	0.770	Isocitrate dehydrogenase 1, cytosolic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004616	1.000	phosphogluconate dehydrogenase (decarboxylating) activity
GO:0005488	0.989	binding
GO:0005515	0.871	protein binding
GO:0097159	0.734	organic cyclic compound binding
GO:1901363	0.728	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0044281	0.996	small molecule metabolic process
GO:1901564	0.993	organonitrogen compound metabolic process
GO:1901360	0.986	organic cyclic compound metabolic process
GO:0034641	0.986	cellular nitrogen compound metabolic process
GO:0046483	0.985	heterocycle metabolic process
GO:0006139	0.981	nucleobase-containing compound metabolic process
GO:0006796	0.971	phosphate-containing compound metabolic process
GO:0055086	0.968	nucleobase-containing small molecule metabolic process
GO:0019637	0.967	organophosphate metabolic process
GO:0006163	0.956	purine nucleotide metabolic process
GO:0006091	0.955	generation of precursor metabolites and energy
GO:0006098	0.948	pentose-phosphate shunt

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.995	organelle
GO:0043231	0.967	intracellular membrane-bounded organelle
GO:0005576	0.878	extracellular region
GO:0005615	0.869	extracellular space
GO:0070013	0.853	intracellular organelle lumen
GO:0031982	0.825	vesicle
GO:0070062	0.621	extracellular exosome
GO:0005739	0.367	mitochondrion
GO:0005634	0.320	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10116	1.000	6-phospho-D-gluconate + NADP(+) = CO2 + D-ribulose 5-phosphate + NADPH
EC:1.1.1.44	1.000	phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).

[back to server]