StarFunc result for job id P52333

User Input

>input (1124 residues)
MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQR
PGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIM
DLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPK
EKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQ
EFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFS
GVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSL
ISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESE
AHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAP
SPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0V237	0.932	0.950	0.000	1103	0.496	0.505	B0V237.pdb.gz	B0V237_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak3 PE=3 SV=1
2	AFDB:F1QWX8	0.647	0.664	0.000	1095	0.492	0.505	F1QWX8.pdb.gz	F1QWX8_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=3 SV=1
3	AFDB:G1TCI4	0.655	0.651	0.000	1132	0.493	0.489	G1TCI4.pdb.gz	G1TCI4_RABIT Tyrosine-protein kinase OS=Oryctolagus cuniculus OX=9986 GN=JAK2 PE=3 SV=2
4	AFDB:P52333	1.000	1.000	0.000	1124	1.000	1.000	P52333.pdb.gz	JAK3_HUMAN Tyrosine-protein kinase JAK3 OS=Homo sapiens OX=9606 GN=JAK3 PE=1 SV=2
5	AFDB:Q62137	0.683	0.698	0.000	1100	0.820	0.838	Q62137.pdb.gz	JAK3_MOUSE Tyrosine-protein kinase JAK3 OS=Mus musculus OX=10090 GN=Jak3 PE=1 SV=2
6	AFDB:P23458	0.887	0.865	6.708E-96	1154	0.400	0.390	P23458.pdb.gz	JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens OX=9606 GN=JAK1 PE=1 SV=2
7	AFDB:D3ZD03	0.877	0.832	4.105E-91	1186	0.403	0.382	D3ZD03.pdb.gz	D3ZD03_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tyk2 PE=1 SV=1
8	AFDB:O12990	0.632	0.616	1.024E-89	1153	0.387	0.377	O12990.pdb.gz	JAK1_DANRE Tyrosine-protein kinase JAK1 OS=Danio rerio OX=7955 GN=jak1 PE=1 SV=1
9	AFDB:S5R2L7	0.633	0.606	3.259E-89	1176	0.384	0.367	S5R2L7.pdb.gz	S5R2L7_SALSA Tyrosine-protein kinase OS=Salmo salar OX=8030 PE=2 SV=1
10	AFDB:P29597	0.616	0.584	1.636E-86	1187	0.402	0.381	P29597.pdb.gz	TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2 OS=Homo sapiens OX=9606 GN=TYK2 PE=1 SV=3
11	PDB:4fl2A	0.217	0.427	5.818E-20	555	0.135	0.274	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:4k2rA	0.210	0.416	1.822E-17	551	0.120	0.245	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	PDB:1k9aB	0.218	0.542	2.288E-16	441	0.085	0.218	1k9aB.pdb.gz
14	PDB:2h8hA	0.216	0.525	3.828E-16	445	0.084	0.211	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:6pjxA	0.221	0.436	1.324E-12	543	0.073	0.151	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
16	PDB:4rewA	0.200	0.518	1.442E-12	411	0.077	0.209	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:5ufuA	0.211	0.607	1.505E-12	369	0.073	0.222	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:2bujA	0.212	0.753	1.787E-12	291	0.057	0.220	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
19	PDB:4rerA	0.200	0.468	2.744E-12	459	0.075	0.183	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:6b1uA	0.210	0.512	3.400E-12	442	0.065	0.165	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GTR9	572	710	0.262	0.415	A0A1B0GTR9_HUMAN Tyrosine-protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=JAK2 PE=1 SV=1
2	A0A8I5ZU24	764	1140	0.391	0.386	A0A8I5ZU24_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
3	A0A8I6AJU1	732	1120	0.376	0.378	A0A8I6AJU1_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
4	A0A8I6AM23	786	1153	0.399	0.389	A0A8I6AM23_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
5	B0V237	1073	1103	0.496	0.506	B0V237_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak3 PE=3 SV=1
6	D3ZD03	702	1186	0.412	0.390	D3ZD03_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tyk2 PE=1 SV=1
7	F1QWX8	1062	1095	0.488	0.500	F1QWX8_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=3 SV=1
8	G1TCI4	1093	1132	0.488	0.485	G1TCI4_RABIT Tyrosine-protein kinase OS=Oryctolagus cuniculus OX=9986 GN=JAK2 PE=3 SV=2
9	G3V9W2	786	1153	0.399	0.389	G3V9W2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=3 SV=1
10	K7GSE8	2023	1103	0.909	0.927	K7GSE8_PIG Tyrosine-protein kinase OS=Sus scrofa OX=9823 GN=JAK3 PE=3 SV=1
11	O12990	754	1153	0.387	0.377	JAK1_DANRE Tyrosine-protein kinase JAK1 OS=Danio rerio OX=7955 GN=jak1 PE=1 SV=1
12	O60674	1095	1132	0.488	0.484	JAK2_HUMAN Tyrosine-protein kinase JAK2 OS=Homo sapiens OX=9606 GN=JAK2 PE=1 SV=2
13	O93596	1063	1095	0.488	0.500	O93596_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=2 SV=1
14	P23458	794	1154	0.400	0.390	JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens OX=9606 GN=JAK1 PE=1 SV=2
15	P29597	716	1187	0.414	0.392	TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2 OS=Homo sapiens OX=9606 GN=TYK2 PE=1 SV=3
16	P52332	786	1153	0.399	0.389	JAK1_MOUSE Tyrosine-protein kinase JAK1 OS=Mus musculus OX=10090 GN=Jak1 PE=1 SV=1
17	P52333	2302	1124	1.000	1.000	JAK3_HUMAN Tyrosine-protein kinase JAK3 OS=Homo sapiens OX=9606 GN=JAK3 PE=1 SV=2
18	Q62120	1095	1132	0.495	0.491	JAK2_MOUSE Tyrosine-protein kinase JAK2 OS=Mus musculus OX=10090 GN=Jak2 PE=1 SV=3
19	Q62137	1830	1100	0.822	0.840	JAK3_MOUSE Tyrosine-protein kinase JAK3 OS=Mus musculus OX=10090 GN=Jak3 PE=1 SV=2
20	Q62689	1098	1132	0.493	0.489	JAK2_RAT Tyrosine-protein kinase JAK2 OS=Rattus norvegicus OX=10116 GN=Jak2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	12	16.4	ABC1 atypical kinase-like domain
2	PF01636 APH	38	15.6	Phosphotransferase enzyme family
3	PF18379 FERM_F1	7.4e-26	101.4	FERM F1 ubiquitin-like domain
4	PF18377 FERM_F2	1.8e-32	123.5	FERM F2 acyl-CoA binding protein-like domain
5	PF12330 Haspin_kinase	7.3e+02	10.5	Haspin like kinase domain
6	PF17887 Jak1_Phl	1.7e-11	55.6	Jak1 pleckstrin homology-like domain
7	PF06293 Kdo	6.3	17.7	Lipopolysaccharide kinase (Kdo/WaaP) family
8	PF14531 Kinase-like	15	16.4	Kinase-like
9	PF18779 LRR_RI_capping	1.9e+02	13.2	Capping Ribonuclease inhibitor Leucine Rich Repeat
10	PF00069 Pkinase	1.7e-62	222.8	Protein kinase domain
11	PF07714 PK_Tyr_Ser-Thr	2.1e-130	445.2	Protein tyrosine and serine/threonine kinase
12	PF00017 SH2	99	14.5	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000391676

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293328	0.999	Signal transducer and activator of transcription 5B
2	9606.ENSP00000363318	0.999	Cytokine receptor common subunit gamma
3	9606.ENSP00000264657	0.998	Signal transducer and activator of transcription 3
4	9606.ENSP00000341208	0.998	Signal transducer and activator of transcription 5A
5	9606.ENSP00000361359	0.997	Tumor necrosis factor receptor superfamily member 5
6	9606.ENSP00000226730	0.995	Interleukin-2
7	9606.ENSP00000305133	0.989	Suppressor of cytokine signaling 5
8	9606.ENSP00000369293	0.989	Interleukin-2 receptor subunit alpha
9	9606.ENSP00000216223	0.988	Interleukin-2 receptor subunit beta
10	9606.ENSP00000330341	0.988	Suppressor of cytokine signaling 3
11	9606.ENSP00000329418	0.986	Suppressor of cytokine signaling 1
12	9606.ENSP00000300134	0.985	Signal transducer and activator of transcription 6
13	9606.ENSP00000354394	0.982	Signal transducer and activator of transcription 1-alpha/beta
14	9606.ENSP00000379111	0.982	Interleukin-4 receptor subunit alpha
15	9606.ENSP00000366746	0.980	Signal transducing adapter molecule 1
16	9606.ENSP00000306157	0.977	Interleukin-7 receptor subunit alpha
17	9606.ENSP00000311857	0.971	Tyrosine-protein phosphatase non-receptor type 2
18	9606.ENSP00000263904	0.970	Signal transducing adapter molecule 2
19	9606.ENSP00000409346	0.968	Cytokine-inducible SH2-containing protein
20	9606.ENSP00000340944	0.966	Tyrosine-protein phosphatase non-receptor type 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0019903	0.912	protein phosphatase binding
GO:0005102	0.753	signaling receptor binding
GO:0005126	0.538	cytokine receptor binding
GO:0004715	0.385	non-membrane spanning protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007166	0.996	cell surface receptor signaling pathway
GO:0042221	0.992	response to chemical
GO:0048518	0.991	positive regulation of biological process
GO:0034097	0.980	response to cytokine
GO:0071310	0.977	cellular response to organic substance
GO:0071345	0.966	cellular response to cytokine stimulus
GO:0019221	0.962	cytokine-mediated signaling pathway
GO:0048522	0.953	positive regulation of cellular process
GO:0019222	0.874	regulation of metabolic process
GO:0002376	0.859	immune system process
GO:0048583	0.839	regulation of response to stimulus
GO:0060255	0.770	regulation of macromolecule metabolic process
GO:0031323	0.747	regulation of cellular metabolic process
GO:0009893	0.710	positive regulation of metabolic process
GO:0051171	0.708	regulation of nitrogen compound metabolic process
GO:0080090	0.681	regulation of primary metabolic process
GO:0032501	0.662	multicellular organismal process
GO:0071704	0.661	organic substance metabolic process
GO:0044237	0.657	cellular metabolic process
GO:0044238	0.635	primary metabolic process
GO:0032502	0.607	developmental process
GO:0023051	0.590	regulation of signaling
GO:0010646	0.588	regulation of cell communication
GO:0010604	0.581	positive regulation of macromolecule metabolic process
GO:0048856	0.580	anatomical structure development
GO:0009966	0.546	regulation of signal transduction
GO:0051239	0.519	regulation of multicellular organismal process
GO:0042127	0.513	regulation of cell population proliferation
GO:0002682	0.511	regulation of immune system process
GO:0006807	0.504	nitrogen compound metabolic process
GO:0048519	0.498	negative regulation of biological process
GO:0048584	0.486	positive regulation of response to stimulus
GO:0010468	0.479	regulation of gene expression
GO:0048523	0.466	negative regulation of cellular process
GO:0043170	0.448	macromolecule metabolic process
GO:0031325	0.436	positive regulation of cellular metabolic process
GO:0010556	0.435	regulation of macromolecule biosynthetic process
GO:0051173	0.430	positive regulation of nitrogen compound metabolic process
GO:0031326	0.419	regulation of cellular biosynthetic process
GO:0019219	0.417	regulation of nucleobase-containing compound metabolic process
GO:0006950	0.394	response to stress
GO:0036211	0.393	protein modification process
GO:0009967	0.389	positive regulation of signal transduction
GO:0006796	0.385	phosphate-containing compound metabolic process
GO:0051252	0.365	regulation of RNA metabolic process
GO:2001141	0.358	regulation of RNA biosynthetic process
GO:0051240	0.332	positive regulation of multicellular organismal process
GO:0006355	0.331	regulation of DNA-templated transcription
GO:0050865	0.329	regulation of cell activation
GO:0051249	0.322	regulation of lymphocyte activation
GO:0006468	0.315	protein phosphorylation
GO:0051246	0.310	regulation of protein metabolic process
GO:0008284	0.308	positive regulation of cell population proliferation
GO:0022407	0.306	regulation of cell-cell adhesion
GO:0007167	0.305	enzyme-linked receptor protein signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.950	plasma membrane
GO:0043226	0.835	organelle
GO:0043229	0.810	intracellular organelle
GO:0043227	0.796	membrane-bounded organelle
GO:0043231	0.756	intracellular membrane-bounded organelle
GO:0005634	0.397	nucleus
GO:0012505	0.357	endomembrane system
GO:0031982	0.357	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.385	non-specific protein-tyrosine kinase.

[back to server]