StarFunc result for job id P52564

User Input

>input (334 residues)
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K3Y2	0.901	0.901	4.599E-58	334	1.000	1.000	A8K3Y2.pdb.gz	A8K3Y2_HUMAN Mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=2 SV=1
2	AFDB:Q9DGE0	0.916	0.848	8.217E-56	361	0.865	0.801	Q9DGE0.pdb.gz	MP2K6_DANRE Dual specificity mitogen-activated protein kinase kinase 6 OS=Danio rerio OX=7955 GN=map2k6 PE=1 SV=2
3	AFDB:Q9I959	0.885	0.736	1.093E-52	404	0.868	0.718	Q9I959.pdb.gz	Q9I959_CYPCA MAP kinase kinase 6 (MKK6) OS=Cyprinus carpio OX=7962 PE=2 SV=1
4	AFDB:B1H230	0.888	0.855	2.018E-52	347	0.796	0.767	B1H230.pdb.gz	B1H230_RAT Map2k3 protein OS=Rattus norvegicus OX=10116 GN=Map2k3 PE=2 SV=1
5	AFDB:Q9U983	0.847	0.845	1.253E-40	335	0.569	0.567	Q9U983.pdb.gz	Q9U983_DROME MAPKK OS=Drosophila melanogaster OX=7227 GN=lic PE=2 SV=1
6	AFDB:B1NA68	0.878	0.728	8.822E-40	404	0.548	0.453	B1NA68.pdb.gz	B1NA68_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=map2k4A PE=1 SV=1
7	AFDB:S4VP54	0.871	0.716	1.233E-39	408	0.545	0.446	S4VP54.pdb.gz	S4VP54_RAT MAP2K4delta OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1
8	AFDB:A4UU31	0.874	0.703	1.303E-39	417	0.548	0.439	A4UU31.pdb.gz	A4UU31_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=MKK4B PE=1 SV=1
9	AFDB:G5EDF7	0.882	0.877	2.845E-39	336	0.503	0.500	G5EDF7.pdb.gz	SEK1_CAEEL Dual specificity mitogen-activated protein kinase kinase sek-1 OS=Caenorhabditis elegans OX=6239 GN=sek-1 PE=1 SV=1
10	PDB:8a8mB	0.736	0.817	4.897E-38	298	0.859	0.963	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
11	AFDB:O61444	0.863	0.684	1.067E-37	424	0.503	0.396	O61444.pdb.gz	O61444_DROME MAP kinase kinase 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Mkk4 PE=1 SV=1
12	PDB:3eqdA	0.772	0.816	1.362E-28	315	0.353	0.375	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
13	PDB:5eymA	0.727	0.827	1.992E-24	292	0.338	0.387	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
14	PDB:6s73A	0.686	0.841	2.563E-19	269	0.225	0.279	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
15	PDB:4ek6A	0.623	0.740	6.153E-18	279	0.216	0.258	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
16	PDB:4eomC	0.627	0.749	2.932E-17	276	0.204	0.246	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
17	PDB:4yc3A	0.619	0.694	6.400E-17	295	0.213	0.241	4yc3A.pdb.gz
18	PDB:3coiA	0.588	0.573	1.057E-16	344	0.207	0.201	3coiA.pdb.gz
19	PDB:4gcjA	0.642	0.702	1.057E-16	304	0.216	0.237	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
20	PDB:6dtlB	0.619	0.583	1.250E-16	357	0.266	0.249	6dtlB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K3Y2	0.0	694	334	1.000	1.000	A8K3Y2_HUMAN Mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=2 SV=1
2	B1H230	0.0	550	347	0.793	0.764	B1H230_RAT Map2k3 protein OS=Rattus norvegicus OX=10116 GN=Map2k3 PE=2 SV=1
3	F7EXM7	0.0	548	340	0.790	0.776	F7EXM7_RAT Mitogen activated protein kinase kinase 3 OS=Rattus norvegicus OX=10116 GN=Map2k3 PE=1 SV=1
4	M0R7E7	0.0	549	419	0.793	0.632	M0R7E7_RAT Mitogen activated protein kinase kinase 3 OS=Rattus norvegicus OX=10116 GN=Map2k3 PE=1 SV=1
5	O09110	0.0	550	347	0.790	0.761	MP2K3_MOUSE Dual specificity mitogen-activated protein kinase kinase 3 OS=Mus musculus OX=10090 GN=Map2k3 PE=1 SV=2
6	P46734	0.0	547	347	0.802	0.772	MP2K3_HUMAN Dual specificity mitogen-activated protein kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP2K3 PE=1 SV=2
7	P52564	0.0	694	334	1.000	1.000	MP2K6_HUMAN Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=1 SV=1
8	P70236	0.0	683	334	0.979	0.979	MP2K6_MOUSE Dual specificity mitogen-activated protein kinase kinase 6 OS=Mus musculus OX=10090 GN=Map2k6 PE=1 SV=1
9	Q925D6	0.0	681	334	0.973	0.973	Q925D6_RAT Mitogen-activated protein kinase kinase 6 OS=Rattus norvegicus OX=10116 GN=Map2k6 PE=1 SV=1
10	Q9DGE0	0.0	582	361	0.835	0.773	MP2K6_DANRE Dual specificity mitogen-activated protein kinase kinase 6 OS=Danio rerio OX=7955 GN=map2k6 PE=1 SV=2
11	Q9I959	0.0	592	404	0.844	0.698	Q9I959_CYPCA MAP kinase kinase 6 (MKK6) OS=Cyprinus carpio OX=7962 PE=2 SV=1
12	Q9U983	3.07e-146	417	335	0.566	0.564	Q9U983_DROME MAPKK OS=Drosophila melanogaster OX=7227 GN=lic PE=2 SV=1
13	O62602	9.98e-146	416	334	0.566	0.566	O62602_DROME Licorne OS=Drosophila melanogaster OX=7227 GN=lic PE=1 SV=1
14	B1NA68	8.79e-127	370	404	0.524	0.433	B1NA68_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=map2k4A PE=1 SV=1
15	A4UU31	3.62e-125	367	417	0.530	0.424	A4UU31_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=MKK4B PE=1 SV=1
16	F1LP57	1.05e-124	364	371	0.512	0.461	F1LP57_RAT Mitogen activated protein kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=4
17	P47809	1.07e-124	365	397	0.512	0.431	MP2K4_MOUSE Dual specificity mitogen-activated protein kinase kinase 4 OS=Mus musculus OX=10090 GN=Map2k4 PE=1 SV=2
18	Q4KSH6	1.07e-124	365	397	0.512	0.431	Q4KSH6_RAT Dual specificity mitogen-activated protein kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1
19	P45985	1.25e-124	365	399	0.512	0.429	MP2K4_HUMAN Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1
20	S4VP54	1.44e-124	365	408	0.512	0.419	S4VP54_RAT MAP2K4delta OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	11	16.6	ABC1 atypical kinase-like domain
2	PF01636 APH	4.9e+02	11.9	Phosphotransferase enzyme family
3	PF01633 Choline_kinase	2.3e+02	12.8	Choline/ethanolamine kinase
4	PF14247 DUF4344	3.1e+02	12.4	Putative metallopeptidase
5	PF12330 Haspin_kinase	90	13.4	Haspin like kinase domain
6	PF14531 Kinase-like	0.51	21.2	Kinase-like
7	PF00069 Pkinase	1.1e-52	190.6	Protein kinase domain
8	PF17667 Pkinase_fungal	27	15.0	Fungal protein kinase
9	PF07714 PK_Tyr_Ser-Thr	5.9e-34	129.1	Protein tyrosine and serine/threonine kinase
10	PF07387 Seadorna_VP7	15	16.1	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003153

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010857	0.994	Mitogen-activated protein kinase 14
2	61853.ENSNLEP00000016274	0.994	Mitogen-activated protein kinase kinase kinase 7
3	61853.ENSNLEP00000013924	0.984	Mitogen-activated protein kinase kinase kinase 4
4	61853.ENSNLEP00000018084	0.972	Mitogen-activated protein kinase kinase kinase 5
5	61853.ENSNLEP00000000724	0.969	Mitogen-activated protein kinase 12
6	61853.ENSNLEP00000010961	0.967	Mitogen-activated protein kinase 13
7	61853.ENSNLEP00000018508	0.956	TGF-beta activated kinase 1/MAP3K7 binding protein 1
8	61853.ENSNLEP00000018944	0.951	Mitogen-activated protein kinase 8
9	61853.ENSNLEP00000011688	0.948	Mitogen-activated protein kinase kinase kinase 6
10	61853.ENSNLEP00000000896	0.944	Belongs to the protein kinase superfamily.
11	61853.ENSNLEP00000018580	0.944	TGF-beta activated kinase 1/MAP3K7 binding protein 2
12	61853.ENSNLEP00000000413	0.940	TAO kinase 3
13	61853.ENSNLEP00000004096	0.939	TAO kinase 1
14	61853.ENSNLEP00000013466	0.938	Receptor (TNFRSF)-interacting serine-threonine kinase 1
15	61853.ENSNLEP00000002707	0.930	Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
16	61853.ENSNLEP00000012346	0.930	TGF-beta activated kinase 1/MAP3K7 binding protein 3
17	61853.ENSNLEP00000011344	0.927	Mitogen-activated protein kinase 10
18	61853.ENSNLEP00000000288	0.926	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
19	61853.ENSNLEP00000002611	0.911	Mitogen-activated protein kinase 9
20	61853.ENSNLEP00000005236	0.909	TNFRSF1A-associated via death domain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004708	1.000	MAP kinase kinase activity
GO:0004674	0.953	protein serine/threonine kinase activity
GO:0019899	0.782	enzyme binding
GO:0042802	0.309	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050896	0.992	response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0048518	0.988	positive regulation of biological process
GO:0051716	0.984	cellular response to stimulus
GO:0048583	0.983	regulation of response to stimulus
GO:0023052	0.977	signaling
GO:0007165	0.971	signal transduction
GO:0019222	0.959	regulation of metabolic process
GO:0023051	0.953	regulation of signaling
GO:0010646	0.953	regulation of cell communication
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0080090	0.949	regulation of primary metabolic process
GO:0006950	0.948	response to stress
GO:0031323	0.939	regulation of cellular metabolic process
GO:0000165	0.927	MAPK cascade
GO:0009966	0.926	regulation of signal transduction
GO:0048522	0.910	positive regulation of cellular process
GO:0043408	0.845	regulation of MAPK cascade
GO:0008152	0.844	metabolic process
GO:0051246	0.840	regulation of protein metabolic process
GO:0009893	0.838	positive regulation of metabolic process
GO:0031399	0.833	regulation of protein modification process
GO:0009967	0.830	positive regulation of signal transduction
GO:0051174	0.827	regulation of phosphorus metabolic process
GO:0032501	0.814	multicellular organismal process
GO:0010604	0.807	positive regulation of macromolecule metabolic process
GO:0051173	0.715	positive regulation of nitrogen compound metabolic process
GO:0031325	0.707	positive regulation of cellular metabolic process
GO:0009889	0.686	regulation of biosynthetic process
GO:1902533	0.682	positive regulation of intracellular signal transduction
GO:0051247	0.679	positive regulation of protein metabolic process
GO:0071704	0.678	organic substance metabolic process
GO:0044237	0.676	cellular metabolic process
GO:0010033	0.658	response to organic substance
GO:0044238	0.640	primary metabolic process
GO:0001934	0.614	positive regulation of protein phosphorylation
GO:0006807	0.611	nitrogen compound metabolic process
GO:0010468	0.593	regulation of gene expression
GO:0070887	0.576	cellular response to chemical stimulus
GO:0019538	0.560	protein metabolic process
GO:0043412	0.557	macromolecule modification
GO:0036211	0.553	protein modification process
GO:0006796	0.550	phosphate-containing compound metabolic process
GO:0010556	0.545	regulation of macromolecule biosynthetic process
GO:0071310	0.541	cellular response to organic substance
GO:0032502	0.523	developmental process
GO:0048856	0.504	anatomical structure development
GO:0080134	0.501	regulation of response to stress
GO:0065009	0.490	regulation of molecular function
GO:0048519	0.484	negative regulation of biological process
GO:0044093	0.461	positive regulation of molecular function
GO:0031326	0.452	regulation of cellular biosynthetic process
GO:0048523	0.448	negative regulation of cellular process
GO:0019219	0.447	regulation of nucleobase-containing compound metabolic process
GO:0016310	0.445	phosphorylation
GO:0006468	0.421	protein phosphorylation
GO:0033554	0.413	cellular response to stress
GO:0050790	0.393	regulation of catalytic activity
GO:0051252	0.375	regulation of RNA metabolic process
GO:2001141	0.365	regulation of RNA biosynthetic process
GO:0006355	0.358	regulation of DNA-templated transcription
GO:0051239	0.352	regulation of multicellular organismal process
GO:0007275	0.328	multicellular organism development
GO:0009605	0.317	response to external stimulus
GO:0051338	0.314	regulation of transferase activity
GO:0007166	0.308	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.990	nucleoplasm
GO:0016020	0.849	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.12.2	1.000	mitogen-activated protein kinase kinase.

[back to server]