StarFunc result for job id P52630

User Input

>input (851 residues)
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLF
FHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILI
QAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQ
AKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKA
QQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLR
NAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVE
VSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQ
NQQFFSNPPKAPWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLL
RFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENP
LRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELES
LELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQG
PVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHF
YTDGPLMPSDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494C164	0.792	0.824	0.000	818	0.961	1.000	A0A494C164.pdb.gz	A0A494C164_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT2 PE=1 SV=1
2	AFDB:P52630	1.000	1.000	0.000	851	1.000	1.000	P52630.pdb.gz	STAT2_HUMAN Signal transducer and activator of transcription 2 OS=Homo sapiens OX=9606 GN=STAT2 PE=1 SV=1
3	AFDB:Q9WVL2	0.814	0.751	6.063E-97	923	0.703	0.648	Q9WVL2.pdb.gz	STAT2_MOUSE Signal transducer and activator of transcription 2 OS=Mus musculus OX=10090 GN=Stat2 PE=1 SV=1
4	AFDB:A0A2R8Q947	0.691	0.788	9.812E-63	741	0.348	0.399	A0A2R8Q947.pdb.gz
5	AFDB:B5X3E8	0.782	0.863	5.301E-60	770	0.342	0.378	B5X3E8.pdb.gz	B5X3E8_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT1 PE=2 SV=1
6	AFDB:Q8AW24	0.715	0.918	3.630E-58	657	0.337	0.437	Q8AW24.pdb.gz
7	PDB:1yvlB	0.703	0.903	1.703E-53	653	0.338	0.441	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
8	AFDB:Q8JFS5	0.661	0.492	3.393E-48	1153	0.295	0.218	Q8JFS5.pdb.gz
9	PDB:6wczA	0.398	0.947	5.615E-39	350	0.408	0.991	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
10	AFDB:Q801X1	0.158	0.744	1.830E-12	176	0.087	0.420	Q801X1.pdb.gz
11	PDB:7mjpA	0.086	0.174	1.055E-2	366	0.020	0.046	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
12	PDB:7tysA	0.085	0.171	6.548E-2	361	0.041	0.097	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
13	PDB:3pjaL	0.085	0.292	7.563E-2	223	0.034	0.130	3pjaL.pdb.gz
14	PDB:1k9aB	0.069	0.127	7.935E-2	441	0.022	0.043	1k9aB.pdb.gz
15	PDB:3oaiA	0.083	0.131	7.935E-2	488	0.027	0.047	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
16	AFDB:Q6ZS17	0.074	0.054	1.168E-1	1223	0.087	0.061	Q6ZS17.pdb.gz	RIPR1_HUMAN Rho family-interacting cell polarization regulator 1 OS=Homo sapiens OX=9606 GN=RIPOR1 PE=1 SV=1
17	PDB:5ghuA	0.092	0.305	1.346E-1	201	0.021	0.090	5ghuA.pdb.gz
18	PDB:7ea3J	0.102	0.099	1.346E-1	883	0.032	0.031	7ea3J.pdb.gz
19	PDB:6ww7B	0.061	0.130	1.412E-1	281	0.061	0.185	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
20	AFDB:Q9VGU4	0.070	0.103	1.416E-1	520	0.081	0.133	Q9VGU4.pdb.gz	Q9VGU4_DROME FI02822p OS=Drosophila melanogaster OX=7227 GN=Leash PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C164	0.0	1650	818	0.961	1.000	A0A494C164_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT2 PE=1 SV=1
2	P52630	0.0	1733	851	1.000	1.000	STAT2_HUMAN Signal transducer and activator of transcription 2 OS=Homo sapiens OX=9606 GN=STAT2 PE=1 SV=1
3	Q6P6Q7	0.0	541	712	0.374	0.447	Q6P6Q7_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat1 PE=2 SV=1
4	Q9QXJ2	0.0	1119	922	0.666	0.615	Q9QXJ2_MOUSE Signal transducer and activator of transcription OS=Mus musculus OX=10090 GN=Stat2 PE=1 SV=1
5	Q9QXK0	0.0	544	749	0.381	0.433	Q9QXK0_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat1 PE=2 SV=1
6	Q9WVL2	0.0	1137	923	0.673	0.621	STAT2_MOUSE Signal transducer and activator of transcription 2 OS=Mus musculus OX=10090 GN=Stat2 PE=1 SV=1
7	R9QE65	0.0	1733	851	1.000	1.000	R9QE65_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT2 PE=3 SV=1
8	X2KK07	0.0	561	813	0.367	0.384	X2KK07_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 PE=2 SV=1
9	X2KN52	0.0	568	805	0.368	0.389	X2KN52_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 PE=2 SV=1
10	F1M9D6	7.96e-180	538	755	0.381	0.429	F1M9D6_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat1 PE=1 SV=3
11	P42225	3.70e-179	536	749	0.376	0.427	STAT1_MOUSE Signal transducer and activator of transcription 1 OS=Mus musculus OX=10090 GN=Stat1 PE=1 SV=1
12	A0A0D9RIE1	5.21e-179	536	750	0.374	0.424	A0A0D9RIE1_CHLSB Signal transducer and activator of transcription OS=Chlorocebus sabaeus OX=60711 GN=STAT1 PE=3 SV=1
13	A0A669KBA4	4.68e-177	531	779	0.383	0.418	A0A669KBA4_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
14	B0JYL6	9.07e-177	530	747	0.374	0.426	B0JYL6_BOVIN Signal transducer and activator of transcription OS=Bos taurus OX=9913 GN=STAT1 PE=1 SV=1
15	J3KPM9	1.97e-176	528	714	0.358	0.427	J3KPM9_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
16	A0A669KB56	2.89e-176	528	748	0.370	0.421	A0A669KB56_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
17	P42224	3.32e-176	528	750	0.370	0.420	STAT1_HUMAN Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=2
18	A0A669KB53	9.90e-176	528	791	0.370	0.398	A0A669KB53_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
19	B9UYM8	9.71e-174	524	802	0.355	0.377	B9UYM8_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT2 PE=2 SV=1
20	A0A669KB68	3.32e-173	521	748	0.367	0.417	A0A669KB68_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01544 CorA	62	14.4	CorA-like Mg2+ transporter protein
2	PF15665 FAM184	4.7e+02	11.9	Family with sequence similarity 184, A and B
3	PF00017 SH2	6.8e-08	43.8	SH2 domain
4	PF12188 STAT2_C	2e-29	112.6	Signal transducer and activator of transcription 2 C terminal
5	PF01017 STAT_alpha	5.7e-44	161.6	STAT protein, all-alpha domain
6	PF02864 STAT_bind	1.1e-27	108.6	STAT protein, DNA binding domain
7	PF02865 STAT_int	9.4e-28	108.4	STAT protein, protein interaction domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315768

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270139	0.999	Interferon alpha/beta receptor 1
2	9606.ENSP00000343957	0.999	Interferon alpha/beta receptor 2
3	9606.ENSP00000380073	0.999	Interferon regulatory factor 9
4	9606.ENSP00000262367	0.996	CREB-binding protein
5	9606.ENSP00000354394	0.994	Signal transducer and activator of transcription 1-alpha/beta
6	9606.ENSP00000431885	0.993	Non-receptor tyrosine-protein kinase TYK2
7	9606.ENSP00000343204	0.991	Tyrosine-protein kinase JAK1
8	9606.ENSP00000380697	0.990	Interferon regulatory factor 7
9	9606.ENSP00000371067	0.988	Tyrosine-protein kinase JAK2
10	9606.ENSP00000369581	0.981	Interferon beta
11	9606.ENSP00000245414	0.980	Interferon regulatory factor 1
12	9606.ENSP00000381601	0.979	Interferon-induced GTP-binding protein Mx1
13	9606.ENSP00000368699	0.977	Ubiquitin-like protein ISG15
14	9606.ENSP00000471896	0.976	Interferon regulatory factor 3
15	9606.ENSP00000360891	0.975	Interferon-induced protein with tetratricopeptide repeats 2
16	9606.ENSP00000360883	0.974	Interferon-induced protein with tetratricopeptide repeats 3
17	9606.ENSP00000342278	0.972	2'-5'-oligoadenylate synthase 2
18	9606.ENSP00000360869	0.972	Interferon-induced protein with tetratricopeptide repeats 1
19	9606.ENSP00000388001	0.970	2'-5'-oligoadenylate synthase 1
20	9606.ENSP00000371471	0.969	Radical S-adenosyl methionine domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044389	1.000	ubiquitin-like protein ligase binding
GO:0042802	0.999	identical protein binding
GO:0003676	0.689	nucleic acid binding
GO:0140110	0.594	transcription regulator activity
GO:0003677	0.568	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0051716	0.989	cellular response to stimulus
GO:0048583	0.978	regulation of response to stimulus
GO:0048519	0.978	negative regulation of biological process
GO:0007165	0.976	signal transduction
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0048518	0.971	positive regulation of biological process
GO:0019219	0.962	regulation of nucleobase-containing compound metabolic process
GO:0042221	0.961	response to chemical
GO:0006950	0.957	response to stress
GO:0010556	0.956	regulation of macromolecule biosynthetic process
GO:0048522	0.950	positive regulation of cellular process
GO:0045088	0.950	regulation of innate immune response
GO:0060759	0.936	regulation of response to cytokine stimulus
GO:0051252	0.934	regulation of RNA metabolic process
GO:0048523	0.932	negative regulation of cellular process
GO:0060338	0.930	regulation of type I interferon-mediated signaling pathway
GO:0007166	0.929	cell surface receptor signaling pathway
GO:0071357	0.905	cellular response to type I interferon
GO:2001141	0.894	regulation of RNA biosynthetic process
GO:0048585	0.889	negative regulation of response to stimulus
GO:0019221	0.886	cytokine-mediated signaling pathway
GO:0010468	0.871	regulation of gene expression
GO:0006355	0.847	regulation of DNA-templated transcription
GO:0002683	0.819	negative regulation of immune system process
GO:0009893	0.753	positive regulation of metabolic process
GO:0009615	0.752	response to virus
GO:0009968	0.746	negative regulation of signal transduction
GO:0010604	0.724	positive regulation of macromolecule metabolic process
GO:0032102	0.712	negative regulation of response to external stimulus
GO:0031348	0.692	negative regulation of defense response
GO:0050777	0.680	negative regulation of immune response
GO:0060761	0.674	negative regulation of response to cytokine stimulus
GO:0140888	0.660	interferon-mediated signaling pathway
GO:0045824	0.603	negative regulation of innate immune response
GO:0097696	0.588	receptor signaling pathway via STAT
GO:0001960	0.552	negative regulation of cytokine-mediated signaling pathway
GO:0007259	0.546	receptor signaling pathway via JAK-STAT
GO:0051173	0.485	positive regulation of nitrogen compound metabolic process
GO:0031325	0.469	positive regulation of cellular metabolic process
GO:0051246	0.453	regulation of protein metabolic process
GO:0045944	0.394	positive regulation of transcription by RNA polymerase II
GO:0031399	0.348	regulation of protein modification process
GO:0050793	0.339	regulation of developmental process
GO:0051239	0.300	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0005886	0.992	plasma membrane
GO:0043231	0.937	intracellular membrane-bounded organelle
GO:0005634	0.934	nucleus
GO:0070013	0.793	intracellular organelle lumen
GO:0031981	0.658	nuclear lumen
GO:0005654	0.563	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]