StarFunc result for job id P52655

User Input

>input (376 residues)
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH
SEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIV
PDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQ
SVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKE
KDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNL
NGRDYIFSKAIGDAEW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99PM3	0.389	0.387	1.503E-45	378	0.971	0.966	Q99PM3.pdb.gz	TF2AA_MOUSE Transcription initiation factor IIA subunit 1 OS=Mus musculus OX=10090 GN=Gtf2a1 PE=1 SV=2
2	PDB:7edxQ	0.260	0.733	7.402E-10	122	0.316	0.975	7edxQ.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
3	PDB:5m4sA	0.121	0.217	1.433E-6	209	0.122	0.220	5m4sA.pdb.gz
4	PDB:1rm1C	0.117	0.377	8.850E-6	116	0.059	0.190	1rm1C.pdb.gz	High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
5	PDB:5fywU	0.119	0.481	1.477E-5	92	0.069	0.283	5fywU.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
6	PDB:7ohaM	0.107	0.315	1.217E-2	107	0.024	0.084	7ohaM.pdb.gz	Structures and implications of TBP-nucleosome complexes.
7	AFDB:Q86NP2	0.084	0.034	5.736E-1	1251	0.173	0.052	Q86NP2.pdb.gz	NELFA_DROME Negative elongation factor A OS=Drosophila melanogaster OX=7227 GN=Nelf-A PE=1 SV=2
8	AFDB:P62484	0.087	0.074	6.071E-1	446	0.157	0.132	P62484.pdb.gz	ABI2_MOUSE Abl interactor 2 OS=Mus musculus OX=10090 GN=Abi2 PE=1 SV=1
9	PDB:2bngC	0.106	0.254	8.206E-1	140	0.011	0.029	2bngC.pdb.gz	Structure of an Atypical Epoxide Hydrolase from Mycobacterium Tuberculosis Gives Insights Into its Function.
10	AFDB:Q8MQE6	0.082	0.048	9.572E-1	781	0.104	0.050	Q8MQE6.pdb.gz	Q8MQE6_CAEEL CRIB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=wsp-1 PE=1 SV=2
11	PDB:7bn9A	0.084	0.055	9.734E-1	630	0.019	0.011	7bn9A.pdb.gz
12	PDB:7r97A	0.073	0.109	1.155	226	0.008	0.013	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
13	PDB:1b9mA	0.073	0.100	1.222	258	0.021	0.031	1b9mA.pdb.gz
14	PDB:1q90A	0.078	0.097	1.222	292	0.019	0.024	1q90A.pdb.gz	An Atypical Haem in the Cytochrome B6F Complex
15	AFDB:Q00IB7	0.073	0.025	1.272	1433	0.168	0.044	Q00IB7.pdb.gz	PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1
16	AFDB:Q8SZS0	0.081	0.042	1.509	952	0.162	0.064	Q8SZS0.pdb.gz	Q8SZS0_DROME LD31046p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
17	AFDB:A0A097PIG6	0.104	0.067	1.790	694	0.122	0.066	A0A097PIG6.pdb.gz	A0A097PIG6_RAT Mitogen-activated protein kinase kinase kinase kinase 4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=2 SV=1
18	AFDB:A0A0B4KGY6	0.079	0.046	1.895	780	0.160	0.077	A0A0B4KGY6.pdb.gz	NOVA_DROME RNA-binding protein Pasilla OS=Drosophila melanogaster OX=7227 GN=ps PE=1 SV=1
19	AFDB:A1Z6M0	0.125	0.037	2.123	1688	0.162	0.036	A1Z6M0.pdb.gz	A1Z6M0_DROME Brahma associated protein 170kD OS=Drosophila melanogaster OX=7227 GN=Bap170 PE=1 SV=1
20	AFDB:Q803V1	0.078	0.041	2.247	863	0.154	0.067	Q803V1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52655	0.0	754	376	1.000	1.000	TF2AA_HUMAN Transcription initiation factor IIA subunit 1 OS=Homo sapiens OX=9606 GN=GTF2A1 PE=1 SV=1
2	Q99PM3	0.0	724	378	0.971	0.966	TF2AA_MOUSE Transcription initiation factor IIA subunit 1 OS=Mus musculus OX=10090 GN=Gtf2a1 PE=1 SV=2
3	Q9UNN4	1.21e-35	137	478	0.191	0.151	TF2AY_HUMAN TFIIA-alpha and beta-like factor OS=Homo sapiens OX=9606 GN=GTF2A1L PE=1 SV=2
4	Q8R4I4	4.45e-34	133	468	0.176	0.141	TF2AY_MOUSE TFIIA-alpha and beta-like factor OS=Mus musculus OX=10090 GN=Gtf2a1l PE=1 SV=2
5	P52654	2.85e-30	121	366	0.125	0.128	TF2AA_DROME Transcription initiation factor IIA subunit 1 OS=Drosophila melanogaster OX=7227 GN=TfIIA-L PE=1 SV=2
6	Q9USU9	7.00e-13	71.2	369	0.101	0.103	TOA1_SCHPO Transcription initiation factor IIA large subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=toa1 PE=1 SV=1
7	P32773	5.35e-11	65.1	286	0.093	0.122	TOA1_YEAST Transcription initiation factor IIA large subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOA1 PE=1 SV=1
8	A0A0R4IPF2	0.017	39.7	2349	0.154	0.025	A0A0R4IPF2_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=crebbpa PE=1 SV=1
9	E1JJE4	2.2	33.1	1615	0.077	0.018	E1JJE4_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
10	Q8IRS0	2.5	32.7	1607	0.077	0.018	Q8IRS0_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
11	Q9W4F5	2.5	32.7	1767	0.077	0.016	Q9W4F5_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
12	X2JCK2	2.7	32.7	1761	0.077	0.016	X2JCK2_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
13	Q7KU30	6.1	31.6	1017	0.045	0.017	Q7KU30_DROME Early gene at 23, isoform C OS=Drosophila melanogaster OX=7227 GN=E23 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03153 TFIIA	1.7e-76	270.5	Transcription factor IIA, alpha/beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000007852

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000008035	0.999	TATA box binding protein
2	60711.ENSCSAP00000018124	0.997	TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation
3	60711.ENSCSAP00000012767	0.977	TATA-box binding protein like 1
4	60711.ENSCSAP00000016578	0.961	General transcription factor IIB
5	60711.ENSCSAP00000003437	0.944	General transcription factor IIE, polypeptide 1, alpha 56kDa
6	60711.ENSCSAP00000005880	0.942	General transcription factor IIF, polypeptide 1, 74kDa
7	60711.ENSCSAP00000007724	0.942	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
8	60711.ENSCSAP00000012876	0.938	ERCC excision repair 3, TFIIH core complex helicase subunit
9	60711.ENSCSAP00000010722	0.929	TATA box binding protein like 2
10	60711.ENSCSAP00000013872	0.921	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
11	60711.ENSCSAP00000009174	0.909	General transcription factor IIH, polypeptide 5
12	60711.ENSCSAP00000011795	0.888	annotation not available
13	60711.ENSCSAP00000007036	0.886	TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa
14	60711.ENSCSAP00000013798	0.885	TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity.
15	60711.ENSCSAP00000001328	0.884	General transcription factor IIH, polypeptide 1, 62kDa
16	60711.ENSCSAP00000010302	0.879	MNAT CDK-activating kinase assembly factor 1
17	60711.ENSCSAP00000006749	0.873	Polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
18	60711.ENSCSAP00000012912	0.872	Polymerase (RNA) II (DNA directed) polypeptide D
19	60711.ENSCSAP00000017520	0.872	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
20	60711.ENSCSAP00000008521	0.867	Polymerase (RNA) II (DNA directed) polypeptide E, 25kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016251	0.999	RNA polymerase II general transcription initiation factor activity
GO:0001099	0.998	basal RNA polymerase II transcription machinery binding
GO:0061629	0.998	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0017025	0.998	TBP-class protein binding
GO:0000979	0.995	RNA polymerase II core promoter sequence-specific DNA binding
GO:0001091	0.895	RNA polymerase II general transcription initiation factor binding
GO:0046983	0.859	protein dimerization activity
GO:0046982	0.841	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0050794	0.997	regulation of cellular process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0019222	0.995	regulation of metabolic process
GO:0006139	0.990	nucleobase-containing compound metabolic process
GO:0060261	0.990	positive regulation of transcription initiation by RNA polymerase II
GO:1901576	0.988	organic substance biosynthetic process
GO:0044249	0.988	cellular biosynthetic process
GO:0090304	0.984	nucleic acid metabolic process
GO:0010467	0.982	gene expression
GO:1901362	0.979	organic cyclic compound biosynthetic process
GO:0009059	0.972	macromolecule biosynthetic process
GO:0018130	0.972	heterocycle biosynthetic process
GO:0044271	0.972	cellular nitrogen compound biosynthetic process
GO:0006366	0.956	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0090575	1.000	RNA polymerase II transcription regulator complex
GO:0016591	1.000	RNA polymerase II, holoenzyme
GO:0005829	0.995	cytosol
GO:0005669	0.831	transcription factor TFIID complex
GO:0005672	0.768	transcription factor TFIIA complex
GO:0032993	0.467	protein-DNA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]