StarFunc result for job id P52657

User Input

>input (109 residues)
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R5Z5	0.992	0.992	7.405E-20	109	1.000	1.000	A0A024R5Z5.pdb.gz
2	AFDB:P52656	0.924	0.950	1.462E-15	106	0.734	0.755	P52656.pdb.gz	T2AG_DROME Transcription initiation factor IIA subunit 2 OS=Drosophila melanogaster OX=7227 GN=TfIIA-S PE=1 SV=1
3	PDB:5m4sA	0.941	0.494	2.599E-15	209	0.927	0.483	5m4sA.pdb.gz
4	AFDB:O74948	0.937	0.937	3.024E-14	109	0.450	0.450	O74948.pdb.gz	T2AG_SCHPO Transcription initiation factor IIA subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=toa2 PE=3 SV=2
5	AFDB:Q9W5B9	0.931	0.948	2.436E-12	107	0.477	0.486	Q9W5B9.pdb.gz	T2AH_DROME Transcription initiation factor IIA subunit 2-2 OS=Drosophila melanogaster OX=7227 GN=TfIIA-S-2 PE=1 SV=1
6	AFDB:P32774	0.861	0.770	5.699E-11	122	0.394	0.352	P32774.pdb.gz	T2AG_YEAST Transcription initiation factor IIA subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOA2 PE=1 SV=1
7	PDB:7ohaM	0.847	0.862	9.524E-11	107	0.394	0.402	7ohaM.pdb.gz	Structures and implications of TBP-nucleosome complexes.
8	PDB:5fywU	0.359	0.423	4.333E-4	92	0.092	0.109	5fywU.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
9	PDB:1rm1C	0.372	0.351	5.549E-4	116	0.083	0.078	1rm1C.pdb.gz	High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
10	PDB:7edxQ	0.359	0.323	8.041E-4	122	0.128	0.115	7edxQ.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
11	AFDB:P32773	0.374	0.147	3.701E-3	286	0.110	0.042	P32773.pdb.gz	TOA1_YEAST Transcription initiation factor IIA large subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOA1 PE=1 SV=1
12	AFDB:P52654	0.376	0.117	3.701E-3	366	0.073	0.022	P52654.pdb.gz	TF2AA_DROME Transcription initiation factor IIA subunit 1 OS=Drosophila melanogaster OX=7227 GN=TfIIA-L PE=1 SV=2
13	AFDB:Q99PM3	0.375	0.113	3.701E-3	378	0.064	0.019	Q99PM3.pdb.gz	TF2AA_MOUSE Transcription initiation factor IIA subunit 1 OS=Mus musculus OX=10090 GN=Gtf2a1 PE=1 SV=2
14	AFDB:Q8R4I4	0.374	0.092	1.198E-2	468	0.064	0.015	Q8R4I4.pdb.gz	TF2AY_MOUSE TFIIA-alpha and beta-like factor OS=Mus musculus OX=10090 GN=Gtf2a1l PE=1 SV=2
15	AFDB:Q9UNN4	0.373	0.090	1.274E-2	478	0.083	0.019	Q9UNN4.pdb.gz	TF2AY_HUMAN TFIIA-alpha and beta-like factor OS=Homo sapiens OX=9606 GN=GTF2A1L PE=1 SV=2
16	PDB:3jb9F	0.319	0.415	5.381E-2	82	0.064	0.085	3jb9F.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
17	PDB:5o9zp	0.280	0.399	1.202E-1	73	0.110	0.164	5o9zp.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
18	PDB:7b9vq	0.315	0.439	1.202E-1	75	0.073	0.107	7b9vq.pdb.gz	Structural basis for conformational equilibrium of the catalytic spliceosome.
19	PDB:6ppnD	0.314	0.382	1.279E-1	88	0.092	0.114	6ppnD.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
20	PDB:3pgwV	0.298	0.314	1.360E-1	103	0.119	0.126	3pgwV.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52657	9.98e-77	223	109	1.000	1.000	T2AG_HUMAN Transcription initiation factor IIA subunit 2 OS=Homo sapiens OX=9606 GN=GTF2A2 PE=1 SV=1
2	O08950	2.93e-76	222	109	0.991	0.991	T2AG_RAT Transcription initiation factor IIA subunit 2 OS=Rattus norvegicus OX=10116 GN=Gtf2a2 PE=3 SV=1
3	Q80ZM7	2.93e-76	222	109	0.991	0.991	T2AG_MOUSE Transcription initiation factor IIA subunit 2 OS=Mus musculus OX=10090 GN=Gtf2a2 PE=1 SV=2
4	P52656	8.35e-55	167	106	0.743	0.764	T2AG_DROME Transcription initiation factor IIA subunit 2 OS=Drosophila melanogaster OX=7227 GN=TfIIA-S PE=1 SV=1
5	O74948	1.52e-35	119	109	0.450	0.450	T2AG_SCHPO Transcription initiation factor IIA subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=toa2 PE=3 SV=2
6	Q9W5B9	1.27e-29	104	107	0.477	0.486	T2AH_DROME Transcription initiation factor IIA subunit 2-2 OS=Drosophila melanogaster OX=7227 GN=TfIIA-S-2 PE=1 SV=1
7	P32774	2.53e-23	88.6	122	0.394	0.352	T2AG_YEAST Transcription initiation factor IIA subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOA2 PE=1 SV=1
8	P71103	0.99	30.4	333	0.183	0.060	PTAS_CLOAB Phosphate acetyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=pta PE=3 SV=2
9	F4HYJ6	2.2	29.6	1206	0.128	0.012	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
10	Q54L31	3.4	28.9	740	0.156	0.023	Q54L31_DICDI EGF-like domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286963 PE=4 SV=1
11	C0MHL9	8.3	28.1	2295	0.147	0.007	POLG_SAFV Genome polyprotein OS=Saffold virus OX=434309 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02751 TFIIA_gamma_C	6.1e-18	76.1	Transcription initiation factor IIA, gamma subunit
2	PF02268 TFIIA_gamma_N	1.3e-19	81.3	Transcription initiation factor IIA, gamma subunit, helical domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006072398.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006049623.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
2	89462.XP_006074924.1	0.997	Transcription initiation factor IIB
3	89462.XP_006074808.1	0.996	TATA-box-binding protein-like
4	89462.XP_006076092.1	0.996	TATA-box-binding protein
5	89462.XP_006057650.1	0.995	General transcription factor IIE subunit 1 isoform X1
6	89462.XP_006045185.1	0.994	General transcription factor IIF subunit 1
7	89462.XP_006047486.1	0.994	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
8	89462.XP_006066216.1	0.994	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
9	89462.XP_006045891.1	0.993	DNA-directed RNA polymerases I, II, and III subunit RPABC5
10	89462.XP_006057210.1	0.992	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 91% coverage of the annotated genomic feature by RNAseq alignments
11	89462.XP_006052217.1	0.991	Transcription initiation factor TFIID subunit 13
12	89462.XP_006076263.1	0.989	General transcription factor IIE subunit 2-like
13	89462.XP_006077054.1	0.989	General transcription factor IIE subunit 2-like
14	89462.XP_006052376.1	0.988	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
15	89462.XP_006067657.1	0.988	TFIIH basal transcription factor complex helicase XPD subunit
16	89462.XP_006072366.1	0.988	Transcription initiation factor TFIID subunit 4-like
17	89462.XP_006075768.1	0.988	General transcription factor IIH subunit 5
18	89462.XP_006041460.1	0.986	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
19	89462.XP_006078462.1	0.986	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: inserted 1 base in 1 codon
20	89462.XP_006049558.1	0.985	Transcription initiation factor TFIID subunit 12 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017025	0.998	TBP-class protein binding
GO:0016251	0.951	RNA polymerase II general transcription initiation factor activity
GO:1901363	0.468	heterocyclic compound binding
GO:0097159	0.468	organic cyclic compound binding
GO:0003676	0.439	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045893	0.996	positive regulation of DNA-templated transcription
GO:0006357	0.995	regulation of transcription by RNA polymerase II
GO:0045944	0.994	positive regulation of transcription by RNA polymerase II
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0010467	0.980	gene expression
GO:0090304	0.971	nucleic acid metabolic process
GO:0006351	0.951	DNA-templated transcription
GO:0006366	0.940	transcription by RNA polymerase II
GO:0006352	0.582	DNA-templated transcription initiation
GO:0071840	0.512	cellular component organization or biogenesis
GO:0016043	0.470	cellular component organization
GO:0065003	0.427	protein-containing complex assembly
GO:0006367	0.403	transcription initiation at RNA polymerase II promoter
GO:0070897	0.325	transcription preinitiation complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.978	protein-containing complex
GO:0030054	0.937	cell junction
GO:1902494	0.878	catalytic complex
GO:0140513	0.853	nuclear protein-containing complex
GO:0140535	0.852	intracellular protein-containing complex
GO:1990234	0.846	transferase complex
GO:0005667	0.821	transcription regulator complex
GO:0016591	0.820	RNA polymerase II, holoenzyme
GO:0090575	0.813	RNA polymerase II transcription regulator complex
GO:0005669	0.620	transcription factor TFIID complex
GO:0005737	0.397	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]