StarFunc result for job id P52701

User Input

>input (1360 residues)
MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPL
ARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFI
REKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRAD
EALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRR
SSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR
KRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSS
RPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQN
FDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKV
ARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSVLEGDPSENYSKYLL
SLKEKEEDSSGHTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGN
LSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVMLPQVLK
GMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTT
RSGAIFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCA
PLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDS
RAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGFKSKILKQVISLQTKNPEG
RFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRN
RIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLIN
AEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGDGPMCRPVIL
LPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIGCEEEEQENGKAYCVLVTGPNMGGK
STLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASI
LMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNV
AVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKA
REFEKMNQSLRLFREVCLASERSTVDAEAVHKLLTLIKEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IAE0	0.762	0.758	0.000	1369	0.601	0.597	A0A0R4IAE0.pdb.gz
2	AFDB:E1BYJ2	0.811	0.825	0.000	1337	0.662	0.673	E1BYJ2.pdb.gz	MSH6_CHICK DNA mismatch repair protein Msh6 OS=Gallus gallus OX=9031 GN=MSH6 PE=3 SV=2
3	AFDB:P52701	1.000	1.000	0.000	1360	1.000	1.000	P52701.pdb.gz	MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2
4	PDB:1ng9A	0.507	0.833	9.331E-50	794	0.169	0.290	1ng9A.pdb.gz	The alternating ATPase domains of MutS control DNA mismatch repair
5	PDB:3thwA	0.507	0.746	1.236E-43	890	0.154	0.236	3thwA.pdb.gz	Mechanism of mismatch recognition revealed by human MutSbeta bound to unpaired DNA loops
6	PDB:7ou2A	0.462	0.831	2.197E-43	721	0.160	0.301	7ou2A.pdb.gz	Cryogenic electron microscopy structures reveal how ATP and DNA binding in MutS coordinates sequential steps of DNA mismatch repair.
7	PDB:7ou2B	0.424	0.842	1.065E-38	650	0.151	0.317	7ou2B.pdb.gz	Cryogenic electron microscopy structures reveal how ATP and DNA binding in MutS coordinates sequential steps of DNA mismatch repair.
8	AFDB:Q19272	0.366	0.364	2.274E-27	1369	0.108	0.107	Q19272.pdb.gz	MSH5_CAEEL MutS protein homolog 5 OS=Caenorhabditis elegans OX=6239 GN=msh-5 PE=1 SV=2
9	PDB:7vwcA	0.107	0.205	1.579E-4	617	0.060	0.131	7vwcA.pdb.gz
10	PDB:7vgfA	0.109	0.236	2.432E-4	550	0.051	0.127	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.
11	PDB:4q4aA	0.117	0.227	1.504E-3	572	0.053	0.126	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
12	PDB:5ykfB	0.108	0.112	5.488E-3	1309	0.057	0.059	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
13	PDB:7s5xE	0.103	0.100	6.975E-3	1412	0.056	0.054	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
14	PDB:3qf4B	0.105	0.215	7.677E-3	588	0.042	0.097	3qf4B.pdb.gz	Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation
15	AFDB:Q9XER9	0.061	0.059	5.239E-1	1392	0.043	0.042	Q9XER9.pdb.gz	HUA2_ARATH ENHANCER OF AG-4 protein 2 OS=Arabidopsis thaliana OX=3702 GN=HUA2 PE=2 SV=1
16	AFDB:F8VPQ2	0.041	0.044	8.462E-1	1261	0.035	0.037	F8VPQ2.pdb.gz	ARI4A_MOUSE AT-rich interactive domain-containing protein 4A OS=Mus musculus OX=10090 GN=Arid4a PE=1 SV=1
17	AFDB:Q9M9N3	0.064	0.103	1.822	769	0.031	0.055	Q9M9N3.pdb.gz	Q9M9N3_ARATH T17B22.17 protein OS=Arabidopsis thaliana OX=3702 GN=PWO1 PE=1 SV=1
18	AFDB:P27715	0.069	0.051	3.399	2155	0.104	0.065	P27715.pdb.gz	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
19	AFDB:A0A0B4KF25	0.031	0.030	3.566	1131	0.035	0.042	A0A0B4KF25.pdb.gz	A0A0B4KF25_DROME Reduction in Cnn dots 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
20	AFDB:Q84V03	0.029	0.043	5.760	778	0.057	0.100	Q84V03.pdb.gz	FB348_ARATH F-box protein At2g16365 OS=Arabidopsis thaliana OX=3702 GN=At2g16365 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2Q695	0.0	2392	1361	0.865	0.864	A0A1W2Q695_RAT DNA mismatch repair protein OS=Rattus norvegicus OX=10116 GN=Msh6 PE=1 SV=2
2	A0A494C0M1	0.0	2622	1261	0.927	1.000	A0A494C0M1_HUMAN DNA mismatch repair protein OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=1
3	D4A0U9	0.0	2293	1336	0.819	0.834	D4A0U9_RAT DNA mismatch repair protein OS=Rattus norvegicus OX=10116 GN=Msh6 PE=1 SV=4
4	E1BYJ2	0.0	1848	1337	0.663	0.675	MSH6_CHICK DNA mismatch repair protein Msh6 OS=Gallus gallus OX=9031 GN=MSH6 PE=3 SV=2
5	O04716	0.0	655	1324	0.304	0.313	MSH6_ARATH DNA mismatch repair protein MSH6 OS=Arabidopsis thaliana OX=3702 GN=MSH6 PE=1 SV=2
6	P52701	0.0	2827	1360	1.000	1.000	MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2
7	P54276	0.0	2376	1358	0.856	0.857	MSH6_MOUSE DNA mismatch repair protein Msh6 OS=Mus musculus OX=10090 GN=Msh6 PE=1 SV=3
8	Q803S7	0.0	1645	1369	0.613	0.609	Q803S7_DANRE DNA mismatch repair protein OS=Danio rerio OX=7955 GN=wu:fb36c12 PE=1 SV=1
9	Q9N3T8	0.0	711	1186	0.293	0.336	Q9N3T8_CAEEL DNA mismatch repair protein OS=Caenorhabditis elegans OX=6239 GN=msh-6 PE=1 SV=2
10	Q9VUM0	0.0	899	1190	0.368	0.421	MSH6_DROME Probable DNA mismatch repair protein Msh6 OS=Drosophila melanogaster OX=7227 GN=Msh6 PE=1 SV=2
11	O74502	7.65e-179	566	1254	0.268	0.290	MSH6_SCHPO DNA mismatch repair protein msh6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msh6 PE=1 SV=1
12	Q03834	5.83e-160	516	1242	0.257	0.282	MSH6_YEAST DNA mismatch repair protein MSH6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSH6 PE=1 SV=1
13	P20585	5.59e-84	301	1137	0.193	0.230	MSH3_HUMAN DNA mismatch repair protein Msh3 OS=Homo sapiens OX=9606 GN=MSH3 PE=1 SV=4
14	P13705	7.13e-83	297	1091	0.204	0.254	MSH3_MOUSE DNA mismatch repair protein Msh3 OS=Mus musculus OX=10090 GN=Msh3 PE=2 SV=3
15	P26359	1.01e-79	286	993	0.187	0.256	MSH3_SCHPO DNA mismatch repair protein msh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msh3 PE=3 SV=1
16	O65607	4.12e-76	277	1081	0.193	0.243	MSH3_ARATH DNA mismatch repair protein MSH3 OS=Arabidopsis thaliana OX=3702 GN=MSH3 PE=1 SV=2
17	Q9SMV7	2.24e-65	244	1109	0.094	0.115	MSH7_ARATH DNA mismatch repair protein MSH7 OS=Arabidopsis thaliana OX=3702 GN=MSH7 PE=1 SV=1
18	Q803R6	6.64e-65	241	936	0.166	0.241	Q803R6_DANRE DNA mismatch repair protein OS=Danio rerio OX=7955 GN=zgc:55333 PE=1 SV=1
19	E9PHA6	4.59e-60	226	921	0.156	0.230	E9PHA6_HUMAN DNA mismatch repair protein OS=Homo sapiens OX=9606 GN=MSH2 PE=1 SV=1
20	A0A2R8Y6P0	6.48e-60	226	924	0.156	0.229	A0A2R8Y6P0_HUMAN DNA mismatch repair protein OS=Homo sapiens OX=9606 GN=MSH2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01624 MutS_I	9.7e-31	117.7	MutS domain I
2	PF05188 MutS_II	1.2e-08	46.7	MutS domain II
3	PF05192 MutS_III	1.2e-36	138.3	MutS domain III
4	PF05190 MutS_IV	5e-17	73.3	MutS family domain IV
5	PF00488 MutS_V	1.4e-67	238.8	MutS domain V
6	PF00855 PWWP	7.7e-17	72.9	PWWP domain
7	PF15823 UPF0524	4.6e+02	11.5	UPF0524 of C3orf70

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234420

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231790	0.999	DNA mismatch repair protein Mlh1
2	9606.ENSP00000233146	0.999	DNA mismatch repair protein Msh2
3	9606.ENSP00000265849	0.999	Mismatch repair endonuclease PMS2
4	9606.ENSP00000352257	0.999	X-ray repair cross-complementing protein 6
5	9606.ENSP00000406046	0.998	DNA polymerase delta catalytic subunit
6	9606.ENSP00000368458	0.997	Proliferating cell nuclear antigen
7	9606.ENSP00000355506	0.994	Exonuclease 1
8	9606.ENSP00000310520	0.993	DNA repair endonuclease XPF
9	9606.ENSP00000322570	0.993	DNA polymerase epsilon catalytic subunit A
10	9606.ENSP00000265081	0.992	DNA mismatch repair protein Msh3
11	9606.ENSP00000278616	0.992	Serine-protein kinase ATM
12	9606.ENSP00000361170	0.991	Adenine DNA glycosylase
13	9606.ENSP00000406490	0.991	PMS1 protein homolog 1
14	9606.ENSP00000305480	0.989	Flap endonuclease 1
15	9606.ENSP00000348020	0.989	DNA mismatch repair protein Mlh3
16	9606.ENSP00000267430	0.988	Fanconi anemia group M protein
17	9606.ENSP00000254719	0.986	Replication protein A 70 kDa DNA-binding subunit
18	9606.ENSP00000013807	0.985	DNA excision repair protein ERCC-1
19	9606.ENSP00000313420	0.982	DNA-dependent protein kinase catalytic subunit
20	9606.ENSP00000375978	0.978	X-ray repair cross-complementing protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003684	0.999	damaged DNA binding
GO:0032137	0.999	guanine/thymine mispair binding
GO:0005515	0.998	protein binding
GO:0003824	0.990	catalytic activity
GO:0140657	0.968	ATP-dependent activity
GO:0097367	0.968	carbohydrate derivative binding
GO:0000166	0.968	nucleotide binding
GO:0043167	0.967	ion binding
GO:0035639	0.951	purine ribonucleoside triphosphate binding
GO:0140640	0.941	catalytic activity, acting on a nucleic acid
GO:0000217	0.936	DNA secondary structure binding
GO:0005524	0.921	ATP binding
GO:0140097	0.909	catalytic activity, acting on DNA
GO:0019899	0.878	enzyme binding
GO:0043531	0.807	ADP binding
GO:0140034	0.769	methylation-dependent protein binding
GO:0000400	0.768	four-way junction DNA binding
GO:0042393	0.761	histone binding
GO:0008094	0.755	ATP-dependent activity, acting on DNA
GO:0035064	0.747	methylated histone binding
GO:0044877	0.735	protein-containing complex binding
GO:0000287	0.726	magnesium ion binding
GO:0032135	0.584	DNA insertion or deletion binding
GO:0032138	0.365	single base insertion or deletion binding
GO:0032142	0.345	single guanine insertion binding
GO:0032143	0.329	single thymine insertion binding
GO:0032405	0.301	MutLalpha complex binding
GO:0032357	0.301	oxidized purine DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006281	0.995	DNA repair
GO:0006298	0.982	mismatch repair
GO:0065007	0.916	biological regulation
GO:0050789	0.908	regulation of biological process
GO:0050794	0.901	regulation of cellular process
GO:0019222	0.815	regulation of metabolic process
GO:0060255	0.789	regulation of macromolecule metabolic process
GO:0051052	0.747	regulation of DNA metabolic process
GO:0048519	0.666	negative regulation of biological process
GO:0048523	0.659	negative regulation of cellular process
GO:0010605	0.504	negative regulation of macromolecule metabolic process
GO:0051172	0.465	negative regulation of nitrogen compound metabolic process
GO:0045934	0.396	negative regulation of nucleobase-containing compound metabolic process
GO:0051053	0.339	negative regulation of DNA metabolic process
GO:0071840	0.326	cellular component organization or biogenesis
GO:0065009	0.325	regulation of molecular function
GO:0016043	0.322	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0140513	0.996	nuclear protein-containing complex
GO:0005829	0.992	cytosol
GO:0032300	0.981	mismatch repair complex
GO:0043232	0.968	intracellular non-membrane-bounded organelle
GO:0012505	0.946	endomembrane system
GO:0005694	0.837	chromosome
GO:0005794	0.544	Golgi apparatus
GO:0032301	0.470	MutSalpha complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]