StarFunc result for job id P52732

User Input

>input (1056 residues)
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL
NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV
ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEY
ITSALESTEEKLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNS
LFNNMEELIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHV
SQIFNMILKEQSLAAESKTVLQELINVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKT
SLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQ
ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFS
QELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER
EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNE
TIKIGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLM
MLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGK
DKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28025	0.388	0.384	0.000	1067	0.562	0.557	P28025.pdb.gz	KI11B_XENLA Kinesin-like protein KIF11-B OS=Xenopus laevis OX=8355 GN=kif11-b PE=1 SV=2
2	AFDB:P52732	1.000	1.000	0.000	1056	1.000	1.000	P52732.pdb.gz	KIF11_HUMAN Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2
3	AFDB:Q6P9P6	0.384	0.385	0.000	1052	0.795	0.798	Q6P9P6.pdb.gz	KIF11_MOUSE Kinesin-like protein KIF11 OS=Mus musculus OX=10090 GN=Kif11 PE=1 SV=1
4	AFDB:F1QK82	0.397	0.395	2.041E-102	1062	0.496	0.493	F1QK82.pdb.gz	F1QK82_DANRE Kinesin family member 11 OS=Danio rerio OX=7955 GN=cb1 PE=1 SV=2
5	AFDB:P46863	0.388	0.384	1.278E-72	1066	0.328	0.325	P46863.pdb.gz	KL61_DROME Kinesin-like protein Klp61F OS=Drosophila melanogaster OX=7227 GN=Klp61F PE=1 SV=2
6	AFDB:P17120	0.348	0.312	3.722E-69	1184	0.317	0.283	P17120.pdb.gz	BIMC_EMENI Kinesin-like protein bimC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bimC PE=2 SV=2
7	AFDB:F4IIS5	0.333	0.337	7.568E-68	1042	0.294	0.298	F4IIS5.pdb.gz	KN5A_ARATH Kinesin-like protein KIN-5A OS=Arabidopsis thaliana OX=3702 GN=KIN5A PE=1 SV=1
8	AFDB:P24339	0.345	0.336	9.050E-58	1085	0.283	0.276	P24339.pdb.gz	CUT7_SCHPO Kinesin-like protein cut7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut7 PE=1 SV=3
9	AFDB:P28742	0.355	0.338	5.393E-57	1111	0.295	0.281	P28742.pdb.gz	KIP1_YEAST Kinesin-like protein KIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIP1 PE=1 SV=1
10	AFDB:G5ECF4	0.343	0.374	2.432E-56	963	0.292	0.320	G5ECF4.pdb.gz	G5ECF4_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=bmk-1 PE=1 SV=1
11	PDB:7wrgA	0.312	0.402	1.625E-30	812	0.130	0.169	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.305	0.406	1.066E-28	783	0.132	0.178	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.259	0.400	1.614E-26	670	0.101	0.160	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:7z8fe	0.086	0.025	1.410E-3	4579	0.054	0.012	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
15	PDB:7qcdB	0.136	0.141	1.174E-2	998	0.067	0.071	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
16	PDB:5j6hA	0.047	0.126	3.031E-2	275	0.015	0.058	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
17	PDB:6sueA	0.163	0.087	3.389E-2	2292	0.035	0.016	6sueA.pdb.gz
18	PDB:5lkiA	0.078	0.058	4.006E-2	1427	0.041	0.030	5lkiA.pdb.gz
19	PDB:7rroA3	0.134	0.348	4.236E-2	334	0.041	0.129	7rroA3.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:7ungA1	0.113	0.249	4.479E-2	391	0.051	0.138	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QK82	0.0	973	1062	0.493	0.491	F1QK82_DANRE Kinesin family member 11 OS=Danio rerio OX=7955 GN=cb1 PE=1 SV=2
2	P28025	0.0	1157	1067	0.566	0.560	KI11B_XENLA Kinesin-like protein KIF11-B OS=Xenopus laevis OX=8355 GN=kif11-b PE=1 SV=2
3	P52732	0.0	2160	1056	1.000	1.000	KIF11_HUMAN Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2
4	Q6P9P6	0.0	1716	1052	0.797	0.800	KIF11_MOUSE Kinesin-like protein KIF11 OS=Mus musculus OX=10090 GN=Kif11 PE=1 SV=1
5	Q91783	0.0	1137	1067	0.567	0.561	KI11A_XENLA Kinesin-like protein KIF11-A OS=Xenopus laevis OX=8355 GN=kif11-a PE=1 SV=1
6	P46863	3.83e-161	506	1066	0.254	0.251	KL61_DROME Kinesin-like protein Klp61F OS=Drosophila melanogaster OX=7227 GN=Klp61F PE=1 SV=2
7	F4IIS5	1.89e-154	488	1042	0.277	0.281	KN5A_ARATH Kinesin-like protein KIN-5A OS=Arabidopsis thaliana OX=3702 GN=KIN5A PE=1 SV=1
8	P17120	4.45e-144	464	1184	0.325	0.290	BIMC_EMENI Kinesin-like protein bimC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bimC PE=2 SV=2
9	G5EGL7	4.85e-140	447	958	0.272	0.300	G5EGL7_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=bmk-1 PE=1 SV=1
10	G5ECF4	5.97e-140	447	963	0.272	0.298	G5ECF4_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=bmk-1 PE=1 SV=1
11	P24339	7.60e-119	394	1085	0.223	0.218	CUT7_SCHPO Kinesin-like protein cut7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut7 PE=1 SV=3
12	P28742	4.38e-113	379	1111	0.241	0.229	KIP1_YEAST Kinesin-like protein KIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIP1 PE=1 SV=1
13	Q6RZZ9	5.19e-112	379	1265	0.192	0.160	KIF13_DICDI Kinesin-related protein 13 OS=Dictyostelium discoideum OX=44689 GN=kif13 PE=1 SV=1
14	P28741	1.05e-101	337	701	0.194	0.292	KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus OX=10090 GN=Kif3a PE=1 SV=2
15	A0A8I6AP89	2.44e-101	336	686	0.178	0.274	A0A8I6AP89_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
16	A0A0G2JUD6	4.46e-101	335	701	0.195	0.294	A0A0G2JUD6_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=2
17	Q9Y496	5.72e-101	335	699	0.177	0.268	KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens OX=9606 GN=KIF3A PE=1 SV=4
18	A0A8I6GCQ1	8.06e-101	334	674	0.175	0.274	A0A8I6GCQ1_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
19	A0A8I6AL48	9.09e-101	334	684	0.177	0.273	A0A8I6AL48_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
20	E9QB71	1.47e-100	334	701	0.173	0.261	E9QB71_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=fc55h04 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00540 Gag_p17	38	15.7	gag gene protein p17 (matrix protein)
2	PF00225 Kinesin	2.1e-111	383.7	Kinesin motor domain
3	PF16796 Microtub_bd	1.2e-19	82.3	Microtubule binding
4	PF13931 Microtub_bind	3.2e-52	188.2	Kinesin-associated microtubule-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260731

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247191	0.999	Disks large-associated protein 5
2	9606.ENSP00000378699	0.998	Cyclin-dependent kinase 1
3	9606.ENSP00000300403	0.997	Targeting protein for Xklp2
4	9606.ENSP00000302530	0.997	Mitotic checkpoint serine/threonine-protein kinase BUB1
5	9606.ENSP00000356379	0.996	Abnormal spindle-like microcephaly-associated protein
6	9606.ENSP00000216911	0.995	Aurora kinase A
7	9606.ENSP00000260363	0.995	Kinesin-like protein KIF23
8	9606.ENSP00000261597	0.995	Kinetochore protein NDC80 homolog
9	9606.ENSP00000296509	0.995	Mitotic spindle assembly checkpoint protein MAD2A
10	9606.ENSP00000358813	0.995	Dual specificity protein kinase TTK
11	9606.ENSP00000361540	0.995	Cell division cycle protein 20 homolog
12	9606.ENSP00000287598	0.994	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
13	9606.ENSP00000377793	0.994	Protein regulator of cytokinesis 1
14	9606.ENSP00000251496	0.993	Condensin complex subunit 3
15	9606.ENSP00000265148	0.993	Centromere-associated protein E
16	9606.ENSP00000300093	0.993	Serine/threonine-protein kinase PLK1
17	9606.ENSP00000313950	0.993	Aurora kinase B
18	9606.ENSP00000453403	0.993	Nucleolar and spindle-associated protein 1
19	9606.ENSP00000288207	0.992	G2/mitotic-specific cyclin-B2
20	9606.ENSP00000404190	0.991	Rac GTPase-activating protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003777	1.000	microtubule motor activity
GO:0019900	1.000	kinase binding
GO:0019901	0.994	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0016043	0.983	cellular component organization
GO:0022402	0.977	cell cycle process
GO:0007017	0.973	microtubule-based process
GO:0050794	0.972	regulation of cellular process
GO:0000226	0.929	microtubule cytoskeleton organization
GO:1903047	0.877	mitotic cell cycle process
GO:0007059	0.865	chromosome segregation
GO:0000819	0.849	sister chromatid segregation
GO:0140014	0.847	mitotic nuclear division
GO:0007051	0.840	spindle organization
GO:0000070	0.839	mitotic sister chromatid segregation
GO:0051225	0.829	spindle assembly
GO:0051726	0.818	regulation of cell cycle
GO:1902850	0.802	microtubule cytoskeleton organization involved in mitosis
GO:0007052	0.742	mitotic spindle organization
GO:0090307	0.557	mitotic spindle assembly
GO:0010564	0.473	regulation of cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0099080	0.999	supramolecular complex
GO:0005819	0.999	spindle
GO:0005829	0.998	cytosol
GO:0005874	0.988	microtubule
GO:0032991	0.985	protein-containing complex
GO:0016020	0.970	membrane
GO:0043227	0.927	membrane-bounded organelle
GO:0005876	0.920	spindle microtubule
GO:0000922	0.906	spindle pole
GO:0005634	0.868	nucleus
GO:0005875	0.855	microtubule associated complex
GO:0005871	0.849	kinesin complex
GO:0005813	0.657	centrosome
GO:0072686	0.592	mitotic spindle
GO:0043233	0.510	organelle lumen
GO:0070013	0.490	intracellular organelle lumen
GO:0031981	0.475	nuclear lumen
GO:0005654	0.392	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]