StarFunc result for job id P52735

User Input

>input (878 residues)
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAV
FINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
LASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLK
EALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFY
LIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKAC
KMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGN
PAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISR
PPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHI
KVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSR
SPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG
DVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52735	1.000	1.000	0.000	878	1.000	1.000	P52735.pdb.gz	VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2
2	AFDB:Q9R0C8	0.623	0.645	1.408E-87	847	0.531	0.550	Q9R0C8.pdb.gz	VAV3_MOUSE Guanine nucleotide exchange factor VAV3 OS=Mus musculus OX=10090 GN=Vav3 PE=1 SV=2
3	AFDB:P15498	0.628	0.652	2.237E-85	845	0.497	0.516	P15498.pdb.gz	VAV_HUMAN Proto-oncogene vav OS=Homo sapiens OX=9606 GN=VAV1 PE=1 SV=4
4	AFDB:Q45FX5	0.594	0.520	1.105E-56	1007	0.301	0.262	Q45FX5.pdb.gz	VAV_CAEEL Protein vav-1 OS=Caenorhabditis elegans OX=6239 GN=vav-1 PE=1 SV=1
5	AFDB:Q9NHV9	0.582	0.640	1.383E-56	793	0.288	0.319	Q9NHV9.pdb.gz	VAV_DROME Protein vav OS=Drosophila melanogaster OX=7227 GN=Vav PE=1 SV=2
6	AFDB:Q9ES28	0.236	0.240	5.451E-19	862	0.200	0.204	Q9ES28.pdb.gz	ARHG7_MOUSE Rho guanine nucleotide exchange factor 7 OS=Mus musculus OX=10090 GN=Arhgef7 PE=1 SV=2
7	AFDB:Q5VV41	0.317	0.386	6.237E-19	709	0.096	0.118	Q5VV41.pdb.gz	ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1
8	AFDB:Q63406	0.240	0.193	6.523E-19	1149	0.150	0.115	Q63406.pdb.gz	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
9	AFDB:O15068	0.235	0.190	7.804E-19	1137	0.147	0.113	O15068.pdb.gz	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
10	AFDB:Q6PDM6	0.232	0.183	9.767E-19	1166	0.154	0.116	Q6PDM6.pdb.gz	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
11	PDB:7rx9A	0.196	0.390	1.476E-16	432	0.106	0.215	7rx9A.pdb.gz
12	PDB:4mt6A	0.270	0.522	4.531E-16	389	0.091	0.206	4mt6A.pdb.gz
13	PDB:1griA	0.100	0.388	1.567E-11	211	0.068	0.284	1griA.pdb.gz
14	PDB:2h8hA	0.104	0.201	8.741E-9	445	0.054	0.106	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:1k9aB	0.108	0.201	1.046E-8	441	0.047	0.093	1k9aB.pdb.gz
16	PDB:4gouA	0.183	0.306	1.369E-8	507	0.072	0.124	4gouA.pdb.gz
17	PDB:3qwyA	0.086	0.405	1.061E-6	170	0.040	0.206	3qwyA.pdb.gz
18	PDB:2lqnA	0.100	0.273	2.603E-6	303	0.055	0.158	2lqnA.pdb.gz
19	PDB:2eyzA	0.098	0.259	6.677E-6	304	0.056	0.161	2eyzA.pdb.gz
20	PDB:3ljuX	0.105	0.234	2.890E-4	373	0.023	0.054	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15498	0.0	845	845	0.502	0.522	VAV_HUMAN Proto-oncogene vav OS=Homo sapiens OX=9606 GN=VAV1 PE=1 SV=4
2	P27870	0.0	841	845	0.508	0.528	VAV_MOUSE Proto-oncogene vav OS=Mus musculus OX=10090 GN=Vav1 PE=1 SV=1
3	P52735	0.0	1839	878	1.000	1.000	VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2
4	P54100	0.0	831	843	0.503	0.524	VAV_RAT Proto-oncogene vav OS=Rattus norvegicus OX=10116 GN=Vav1 PE=2 SV=1
5	Q60992	0.0	1725	868	0.948	0.959	VAV2_MOUSE Guanine nucleotide exchange factor VAV2 OS=Mus musculus OX=10090 GN=Vav2 PE=1 SV=1
6	Q96D37	0.0	761	790	0.449	0.499	Q96D37_HUMAN VAV1 protein OS=Homo sapiens OX=9606 GN=VAV1 PE=1 SV=2
7	Q9R0C8	0.0	941	847	0.536	0.556	VAV3_MOUSE Guanine nucleotide exchange factor VAV3 OS=Mus musculus OX=10090 GN=Vav3 PE=1 SV=2
8	Q9UKW4	0.0	936	847	0.531	0.550	VAV3_HUMAN Guanine nucleotide exchange factor VAV3 OS=Homo sapiens OX=9606 GN=VAV3 PE=1 SV=1
9	Q9NHV9	2.51e-110	359	793	0.285	0.315	VAV_DROME Protein vav OS=Drosophila melanogaster OX=7227 GN=Vav PE=1 SV=2
10	Q45FX5	2.92e-104	348	1007	0.320	0.279	VAV_CAEEL Protein vav-1 OS=Caenorhabditis elegans OX=6239 GN=vav-1 PE=1 SV=1
11	Q69ZK0	2.69e-23	109	1650	0.117	0.062	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
12	Q3LAC4	5.98e-23	108	1598	0.110	0.061	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2
13	Q70Z35	9.10e-23	107	1606	0.109	0.060	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
14	D3ZS72	1.08e-22	107	1635	0.112	0.060	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
15	A0A8I6GLR6	1.30e-22	107	1646	0.112	0.060	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
16	Q8TCU6	1.69e-22	106	1659	0.113	0.060	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
17	Q9TW28	2.99e-22	105	1737	0.081	0.041	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
18	F1R6J2	3.15e-22	105	1622	0.097	0.052	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
19	A1L390	6.48e-22	104	1219	0.098	0.071	PKHG3_HUMAN Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3 PE=1 SV=1
20	Q9H7P9	1.19e-21	103	1386	0.097	0.061	PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	3.8e-06	38.0	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	37	16.1	C1 domain
3	PF11971 CAMSAP_CH	1.4e-23	93.8	CAMSAP CH domain
4	PF06395 CDC24	25	16.6	CDC24 Calponin
5	PF00307 CH	2.6e-19	80.8	Calponin homology (CH) domain
6	PF12652 CotJB	4.5e+02	12.5	CotJB protein
7	PF00169 PH	0.00037	32.3	PH domain
8	PF15411 PH_10	55	15.5	Pleckstrin homology domain
9	PF00621 RhoGEF	2.6e-37	140.3	RhoGEF domain
10	PF00017 SH2	9.1e-14	62.6	SH2 domain
11	PF00018 SH3_1	1.4e-16	71.1	SH3 domain
12	PF07653 SH3_2	2.4e-22	89.8	Variant SH3 domain
13	PF14604 SH3_9	4.8e-16	69.7	Variant SH3 domain
14	PF08746 zf-RING-like	4.9e+02	12.3	RING-like domain
15	PF17120 zf-RING_16	5.3e+02	11.7	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360916

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382004	0.996	Catenin delta-1
2	9606.ENSP00000400175	0.993	Transforming protein RhoA
3	9606.ENSP00000364907	0.984	Tyrosine-protein kinase SYK
4	9606.ENSP00000383118	0.983	Cell division control protein 42 homolog
5	9606.ENSP00000348461	0.978	Ras-related C3 botulinum toxin substrate 1
6	9606.ENSP00000462521	0.976	Thioredoxin-interacting protein
7	9606.ENSP00000249071	0.973	Ras-related C3 botulinum toxin substrate 2
8	9606.ENSP00000339467	0.973	Rho-related GTP-binding protein RhoG
9	9606.ENSP00000275493	0.972	Epidermal growth factor receptor
10	9606.ENSP00000272233	0.958	Rho-related GTP-binding protein RhoB
11	9606.ENSP00000437940	0.956	B-lymphocyte antigen CD19
12	9606.ENSP00000351209	0.947	Ephrin type-A receptor 2
13	9606.ENSP00000376345	0.947	Growth factor receptor-bound protein 2
14	9606.ENSP00000263923	0.943	Vascular endothelial growth factor receptor 2
15	9606.ENSP00000358723	0.941	Ras-related protein Rap-1A
16	9606.ENSP00000362680	0.941	Proto-oncogene tyrosine-protein kinase Src
17	9606.ENSP00000422168	0.940	SH3 domain-binding protein 2
18	9606.ENSP00000357392	0.938	Ephrin-A1
19	9606.ENSP00000281821	0.936	Ephrin type-A receptor 4
20	9606.ENSP00000428924	0.934	Tyrosine-protein kinase Lyn

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0001784	0.992	phosphotyrosine residue binding
GO:0005102	0.792	signaling receptor binding
GO:0019899	0.556	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0051716	0.989	cellular response to stimulus
GO:0023052	0.987	signaling
GO:0007154	0.985	cell communication
GO:0007165	0.983	signal transduction
GO:0048518	0.978	positive regulation of biological process
GO:0050776	0.961	regulation of immune response
GO:0048522	0.959	positive regulation of cellular process
GO:0019222	0.944	regulation of metabolic process
GO:0007166	0.926	cell surface receptor signaling pathway
GO:0032501	0.924	multicellular organismal process
GO:0051338	0.921	regulation of transferase activity
GO:0009966	0.921	regulation of signal transduction
GO:0002376	0.917	immune system process
GO:0071840	0.904	cellular component organization or biogenesis
GO:0016043	0.892	cellular component organization
GO:0048584	0.890	positive regulation of response to stimulus
GO:0051179	0.886	localization
GO:0042325	0.877	regulation of phosphorylation
GO:0007169	0.877	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0043550	0.871	regulation of lipid kinase activity
GO:0051336	0.851	regulation of hydrolase activity
GO:0042221	0.850	response to chemical
GO:0043085	0.815	positive regulation of catalytic activity
GO:0016477	0.782	cell migration
GO:0007264	0.763	small GTPase mediated signal transduction
GO:0043087	0.757	regulation of GTPase activity
GO:0030032	0.738	lamellipodium assembly
GO:0051234	0.730	establishment of localization
GO:1902531	0.722	regulation of intracellular signal transduction
GO:0050778	0.707	positive regulation of immune response
GO:0050817	0.696	coagulation
GO:0006950	0.655	response to stress
GO:0002768	0.617	immune response-regulating cell surface receptor signaling pathway
GO:0006810	0.605	transport
GO:0032502	0.562	developmental process
GO:0002757	0.552	immune response-activating signaling pathway
GO:0070887	0.550	cellular response to chemical stimulus
GO:0048856	0.544	anatomical structure development
GO:0080090	0.535	regulation of primary metabolic process
GO:0009893	0.532	positive regulation of metabolic process
GO:0048010	0.509	vascular endothelial growth factor receptor signaling pathway
GO:0009611	0.490	response to wounding
GO:0016192	0.489	vesicle-mediated transport
GO:0031325	0.487	positive regulation of cellular metabolic process
GO:0065008	0.483	regulation of biological quality
GO:0043551	0.410	regulation of phosphatidylinositol 3-kinase activity
GO:0002429	0.388	immune response-activating cell surface receptor signaling pathway
GO:0051239	0.375	regulation of multicellular organismal process
GO:0060255	0.374	regulation of macromolecule metabolic process
GO:0001775	0.373	cell activation
GO:0045937	0.370	positive regulation of phosphate metabolic process
GO:0042060	0.361	wound healing
GO:0051171	0.348	regulation of nitrogen compound metabolic process
GO:0042327	0.323	positive regulation of phosphorylation
GO:0050878	0.322	regulation of body fluid levels
GO:0010604	0.307	positive regulation of macromolecule metabolic process
GO:0007599	0.302	hemostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005886	0.993	plasma membrane
GO:0043231	0.357	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]