StarFunc result for job id P52736

User Input

>input (654 residues)
MAFRDVAVDFTQDEWRLLSPAQRTLYREVMLENYSNLVSLGISFSKPELITQLEQGKETW
REEKKCSPATCPADPEPELYLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCAEGNIQPG
DPGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLGAFSRPPQRQPVSSRNG
LRGVELEASPAQSGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLLSHQRIHSGEK
PYVCGVCEKGFSLKKSLARHQKAHSGEKPIVCRECGRGFNRKSTLIIHERTHSGEKPYMC
SECGRGFSQKSNLIIHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCSDCG
LGFSDRSNLISHQRTHSGEKPYACKECGRCFRQRTTLVNHQRTHSKEKPYVCGVCGHSFS
QNSTLISHRRTHTGEKPYVCGVCGRGFSLKSHLNRHQNIHSGEKPIVCKDCGRGFSQQSN
LIRHQRTHSGEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCRECGRGFSHQAGLIRH
KRKHSREKPYMCRQCGLGFGNKSALITHKRAHSEEKPCVCRECGQGFLQKSHLTLHQMTH
TGEKPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPCAGQPSDSLYSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52736	1.000	1.000	2.550E-102	654	1.000	1.000	P52736.pdb.gz	ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens OX=9606 GN=ZNF133 PE=1 SV=2
2	AFDB:Q9Y3M9	0.388	0.343	9.690E-58	751	0.503	0.438	Q9Y3M9.pdb.gz	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
3	AFDB:A0A024R4I3	0.570	0.572	3.176E-55	652	0.420	0.422	A0A024R4I3.pdb.gz
4	AFDB:Q06732	0.352	0.299	3.350E-55	778	0.440	0.370	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
5	AFDB:Q14929	0.434	0.467	6.044E-55	603	0.463	0.502	Q14929.pdb.gz	ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens OX=9606 GN=ZNF169 PE=1 SV=3
6	AFDB:Q14587	0.532	0.382	7.490E-55	947	0.424	0.293	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
7	AFDB:P51523	0.586	0.523	1.281E-54	738	0.433	0.383	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
8	AFDB:Q6ECI4	0.512	0.474	2.318E-53	717	0.402	0.367	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
9	AFDB:Q9BX82	0.539	0.560	2.723E-53	626	0.382	0.399	Q9BX82.pdb.gz	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
10	AFDB:P17014	0.589	0.554	4.912E-53	697	0.436	0.409	P17014.pdb.gz	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
11	PDB:3w5kB	0.079	0.268	8.739E-4	110	0.064	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7ena4	0.062	0.077	4.641E-1	457	0.081	0.116	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:7uhyC	0.040	0.044	7.127E-1	578	0.028	0.031	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:7ad8D	0.051	0.088	8.371E-1	280	0.050	0.118	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
15	PDB:7ungi	0.039	0.079	8.371E-1	250	0.060	0.156	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:6gejS	0.047	0.109	1.037	208	0.047	0.149	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:7dvqM	0.054	0.133	1.218	191	0.049	0.168	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:5c8dE	0.082	0.130	1.431	280	0.049	0.114	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
19	PDB:5dkaA	0.053	0.242	1.871	96	0.028	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
20	PDB:7o4iW	0.038	0.068	1.871	312	0.034	0.071	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94892	0.0	551	652	0.427	0.428	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
2	P52736	0.0	1341	654	1.000	1.000	ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens OX=9606 GN=ZNF133 PE=1 SV=2
3	Q14929	0.0	581	603	0.486	0.527	ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens OX=9606 GN=ZNF169 PE=1 SV=3
4	Q6P1L6	0.0	575	599	0.474	0.518	ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens OX=9606 GN=ZNF343 PE=1 SV=1
5	Q9NQV7	0.0	568	894	0.450	0.329	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
6	Q9Y3M9	0.0	583	751	0.489	0.426	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
7	Q6ECI4	1.38e-168	501	717	0.399	0.364	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
8	P52742	6.40e-167	494	658	0.424	0.421	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
9	Q8N184	1.07e-166	493	647	0.425	0.430	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
10	Q96EQ9	6.10e-166	498	843	0.387	0.300	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
11	Q14587	3.18e-163	494	947	0.417	0.288	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
12	P35789	3.85e-163	483	620	0.394	0.416	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
13	P51523	1.06e-160	481	738	0.356	0.316	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
14	Q9BX82	2.29e-160	476	626	0.391	0.409	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
15	A6NNF4	6.11e-159	472	616	0.398	0.422	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
16	P17097	5.01e-158	473	686	0.428	0.408	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1
17	Q8TAQ5	1.20e-157	471	688	0.411	0.391	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
18	O75290	6.64e-157	468	641	0.402	0.410	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
19	Q5MCW4	2.80e-156	468	686	0.341	0.325	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
20	Q9P2J8	1.71e-155	472	865	0.387	0.292	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10403 BHD_1	33	15.8	Rad4 beta-hairpin domain 1
2	PF05864 Chordopox_RPO7	70	15.1	Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7)
3	PF11672 DUF3268	11	17.7	zinc-finger-containing domain
4	PF12833 HTH_18	2.2e+02	13.5	Helix-turn-helix domain
5	PF01352 KRAB	2.6e-21	86.3	KRAB box
6	PF00096 zf-C2H2	3.5e-78	265.1	Zinc finger, C2H2 type
7	PF16622 zf-C2H2_11	2.7e-05	35.1	zinc-finger C2H2-type
8	PF18868 zf-C2H2_3rep	0.076	25.1	Zinc finger C2H2-type, 3 repeats
9	PF13894 zf-C2H2_4	8.7e-46	161.6	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	0.0001	33.4	C2H2-type zinc finger
11	PF12171 zf-C2H2_jaz	1.7e-14	64.9	Zinc-finger double-stranded RNA-binding
12	PF13465 zf-H2C2_2	4.3e-73	250.0	Zinc-finger double domain
13	PF17772 zf-MYST	52	14.9	MYST family zinc finger domain
14	PF17032 zinc_ribbon_15	3.3e-05	35.9	zinc-ribbon family
15	PF09723 Zn-ribbon_8	4.1e-06	38.1	Zinc ribbon domain
16	PF17283 Zn_ribbon_SprT	11	17.4	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000014785

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000011261	0.575	DNA-directed RNA polymerase III subunit RPC6
2	9593.ENSGGOP00000011970	0.563	Histatin 3
3	9593.ENSGGOP00000011841	0.506	CCAAT/enhancer binding protein (C/EBP), gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003690	0.788	double-stranded DNA binding
GO:0140110	0.735	transcription regulator activity
GO:0003700	0.720	DNA-binding transcription factor activity
GO:1990837	0.491	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0019222	0.926	regulation of metabolic process
GO:0080090	0.922	regulation of primary metabolic process
GO:0051171	0.922	regulation of nitrogen compound metabolic process
GO:0050794	0.889	regulation of cellular process
GO:0060255	0.767	regulation of macromolecule metabolic process
GO:0031323	0.670	regulation of cellular metabolic process
GO:0010556	0.630	regulation of macromolecule biosynthetic process
GO:0031326	0.630	regulation of cellular biosynthetic process
GO:0010468	0.503	regulation of gene expression
GO:0048523	0.494	negative regulation of cellular process
GO:0009987	0.452	cellular process
GO:0045892	0.428	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.996	nuclear lumen
GO:0005654	0.982	nucleoplasm
GO:0043232	0.304	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]