StarFunc result for job id P52737

User Input

>input (540 residues)
MDSVAFEDVDVNFTQEEWALLDPSQKNLYRDVMWETMRNLASIGKKWKDQNIKDHYKHRG
RNLRSHMLERLYQTKDGSQRGGIFSQFANQNLSKKIPGVKLCESIVYGEVSMGQSSLNRH
IKDHSGHEPKEYQEYGEKPDTRNQCWKPFSSHHSFRTHEIIHTGEKLYDCKECGKTFFSL
KRIRRHIITHSGYTPYKCKVCGKAFDYPSRFRTHERSHTGEKPYECQECGKAFTCITSVR
RHMIKHTGDGPYKCKVCGKPFHSLSSFQVHERIHTGEKPFKCKQCGKAFSCSPTLRIHER
THTGEKPYECKQCGKAFSYLPSLRLHERIHTGEKPFVCKQCGKAFRSASTFQIHERTHTG
EKPYECKECGEAFSCIPSMRRHMIKHTGEGPYKCKVCGKPFHSLSPFRIHERTHTGEKPY
VCKHCGKAFVSSTSIRIHERTHTGEKPYECKQCGKAFSYLNSFRTHEMIHTGEKPFECKR
CGKAFRSSSSFRLHERTHTGQKPYHCKECGKAYSCRASFQRHMLTHAEDGPPYKCMWESL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52737	1.000	1.000	2.319E-92	540	1.000	1.000	P52737.pdb.gz	ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens OX=9606 GN=ZNF136 PE=1 SV=1
2	AFDB:Q8N7K0	0.280	0.229	5.769E-60	673	0.613	0.492	Q8N7K0.pdb.gz	ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens OX=9606 GN=ZNF433 PE=1 SV=1
3	AFDB:Q8TBZ8	0.517	0.507	4.299E-59	553	0.626	0.611	Q8TBZ8.pdb.gz	ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens OX=9606 GN=ZNF564 PE=1 SV=1
4	AFDB:Q8N8Z8	0.439	0.355	8.148E-57	693	0.607	0.473	Q8N8Z8.pdb.gz	ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens OX=9606 GN=ZNF441 PE=1 SV=2
5	AFDB:Q9UC07	0.374	0.360	6.420E-56	566	0.565	0.539	Q9UC07.pdb.gz	ZNF69_HUMAN Zinc finger protein 69 OS=Homo sapiens OX=9606 GN=ZNF69 PE=1 SV=2
6	AFDB:Q9Y2A4	0.297	0.251	7.590E-56	671	0.594	0.478	Q9Y2A4.pdb.gz	ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens OX=9606 GN=ZNF443 PE=2 SV=2
7	AFDB:Q3KP31	0.307	0.288	2.896E-55	576	0.593	0.556	Q3KP31.pdb.gz	ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens OX=9606 GN=ZNF791 PE=1 SV=1
8	AFDB:P17024	0.415	0.420	3.189E-54	532	0.561	0.570	P17024.pdb.gz	ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens OX=9606 GN=ZNF20 PE=1 SV=2
9	AFDB:Q99PJ6	0.481	0.369	6.586E-54	736	0.526	0.386	Q99PJ6.pdb.gz	Q99PJ6_RAT RCG38839 OS=Rattus norvegicus OX=10116 GN=Zfp709 PE=2 SV=1
10	AFDB:E9QAG8	0.382	0.389	5.488E-53	526	0.463	0.475	E9QAG8.pdb.gz	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1
11	PDB:3w5kB	0.092	0.275	2.933E-4	110	0.072	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6gejS	0.051	0.094	9.046E-1	208	0.069	0.178	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:7ad8D	0.041	0.065	9.046E-1	280	0.052	0.100	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
14	PDB:6wkrC	0.060	0.056	1.069	606	0.096	0.086	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
15	PDB:7pmkQ	0.053	0.043	1.131	766	0.052	0.037	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
16	PDB:6hivBI	0.088	0.123	1.767	319	0.080	0.135	6hivBI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:5c8dE	0.071	0.110	1.868	280	0.050	0.096	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
18	PDB:7tveG	0.054	0.082	1.975	307	0.059	0.104	7tveG.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
19	PDB:5gm6a	0.035	0.110	2.209	123	0.035	0.154	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:6g90T	0.053	0.060	2.209	462	0.057	0.067	6g90T.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17024	0.0	572	532	0.561	0.570	ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens OX=9606 GN=ZNF20 PE=1 SV=2
2	P52737	0.0	1115	540	1.000	1.000	ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens OX=9606 GN=ZNF136 PE=1 SV=1
3	Q3KP31	0.0	609	576	0.589	0.552	ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens OX=9606 GN=ZNF791 PE=1 SV=1
4	Q7L945	0.0	594	461	0.552	0.646	ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens OX=9606 GN=ZNF627 PE=1 SV=1
5	Q8N7K0	0.0	597	673	0.602	0.483	ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens OX=9606 GN=ZNF433 PE=1 SV=1
6	Q8N8Z8	0.0	580	693	0.617	0.481	ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens OX=9606 GN=ZNF441 PE=1 SV=2
7	Q8TA94	0.0	528	476	0.507	0.576	ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens OX=9606 GN=ZNF563 PE=1 SV=1
8	Q8TBZ8	0.0	674	553	0.626	0.611	ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens OX=9606 GN=ZNF564 PE=1 SV=1
9	Q9UC07	0.0	592	566	0.569	0.542	ZNF69_HUMAN Zinc finger protein 69 OS=Homo sapiens OX=9606 GN=ZNF69 PE=1 SV=2
10	Q9ULM2	0.0	540	529	0.511	0.522	ZN490_HUMAN Zinc finger protein 490 OS=Homo sapiens OX=9606 GN=ZNF490 PE=1 SV=2
11	Q9Y2A4	0.0	594	671	0.591	0.475	ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens OX=9606 GN=ZNF443 PE=2 SV=2
12	Q99PJ6	2.58e-180	527	736	0.535	0.393	Q99PJ6_RAT RCG38839 OS=Rattus norvegicus OX=10116 GN=Zfp709 PE=2 SV=1
13	Q8NEP9	1.07e-179	521	628	0.541	0.465	ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens OX=9606 GN=ZNF555 PE=1 SV=4
14	A0A0U1RQ46	4.80e-177	514	609	0.493	0.437	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
15	Q8NDP4	2.95e-175	505	499	0.493	0.533	ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens OX=9606 GN=ZNF439 PE=1 SV=1
16	E9QAG8	3.19e-175	506	526	0.478	0.490	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1
17	Q8IYI8	5.08e-174	506	595	0.515	0.467	ZN440_HUMAN Zinc finger protein 440 OS=Homo sapiens OX=9606 GN=ZNF440 PE=1 SV=1
18	Q8N8L2	2.05e-168	486	437	0.485	0.600	ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens OX=9606 GN=ZNF491 PE=1 SV=1
19	E9Q981	2.85e-164	483	636	0.470	0.399	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
20	A0A087WSF4	2.05e-163	480	635	0.469	0.398	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12552 DUF3741	6.2	18.1	Protein of unknown function (DUF3741)
2	PF12961 DUF3850	9.3	17.9	Domain of unknown function (DUF3850)
3	PF13475 DUF4116	9.6e+02	10.9	Domain of unknown function (DUF4116)
4	PF10416 IBD	72	14.8	Transcription-initiator DNA-binding domain IBD
5	PF01352 KRAB	1.3e-19	80.8	KRAB box
6	PF01428 zf-AN1	1.6	20.3	AN1-like Zinc finger
7	PF00096 zf-C2H2	3.7e-44	157.9	Zinc finger, C2H2 type
8	PF16622 zf-C2H2_11	5.7e-07	40.5	zinc-finger C2H2-type
9	PF13894 zf-C2H2_4	1.1e-45	161.3	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	8.9e-25	97.4	C2H2-type zinc finger
11	PF12171 zf-C2H2_jaz	4.5e-13	60.3	Zinc-finger double-stranded RNA-binding
12	PF13465 zf-H2C2_2	6.8e-96	322.1	Zinc-finger double domain
13	PF13451 zf-trcl	7.1	17.9	Probable zinc-ribbon domain
14	PF18439 zf_UBZ	1.1e+02	13.9	Ubiquitin-Binding Zinc Finger
15	PF17032 zinc_ribbon_15	0.62	22.2	zinc-ribbon family
16	PF09723 Zn-ribbon_8	1e-09	49.7	Zinc ribbon domain
17	PF17283 Zn_ribbon_SprT	5.8e-12	56.7	SprT-like zinc ribbon domain
18	PF12760 Zn_Tnp_IS1595	3.8e+02	12.4	Transposase zinc-ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344162

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432561	0.740	Histatin-3
2	9606.ENSP00000302100	0.544	Galectin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.992	biological regulation
GO:0050789	0.969	regulation of biological process
GO:0050794	0.957	regulation of cellular process
GO:0010468	0.912	regulation of gene expression
GO:0051171	0.890	regulation of nitrogen compound metabolic process
GO:0080090	0.888	regulation of primary metabolic process
GO:0031323	0.884	regulation of cellular metabolic process
GO:0051252	0.872	regulation of RNA metabolic process
GO:0048523	0.819	negative regulation of cellular process
GO:0009889	0.807	regulation of biosynthetic process
GO:0006355	0.765	regulation of DNA-templated transcription
GO:0031324	0.686	negative regulation of cellular metabolic process
GO:0051172	0.680	negative regulation of nitrogen compound metabolic process
GO:0010605	0.676	negative regulation of macromolecule metabolic process
GO:0009987	0.627	cellular process
GO:0051253	0.622	negative regulation of RNA metabolic process
GO:0009890	0.371	negative regulation of biosynthetic process
GO:0006357	0.357	regulation of transcription by RNA polymerase II
GO:1902679	0.357	negative regulation of RNA biosynthetic process
GO:0045892	0.352	negative regulation of DNA-templated transcription
GO:0000122	0.334	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0016020	0.990	membrane
GO:0071944	0.968	cell periphery
GO:0005829	0.860	cytosol
GO:0005886	0.817	plasma membrane
GO:0043233	0.439	organelle lumen
GO:0070013	0.394	intracellular organelle lumen
GO:0031981	0.337	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]