StarFunc result for job id P52739

User Input

>input (623 residues)
MEAEETMECLQEFPEHHKMILDRLNEQREQDRFTDITLIVDGHHFKAHKAVLAACSKFFY
KFFQEFTQEPLVEIEGVSKMAFRHLIEFTYTAKLMIQGEEEANDVWKAAEFLQMLEAIKA
LEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITESLPSAESEPVEIEVEIAEGTIEVE
DEGIETLEEVASAKQSVKYIQSTGSSDDSALALLADITSKYRQGDRKGQIKEDGCPSDPT
SKQVEGIEIVELQLSHVKDLFHCEKCNRSFKLFYHFKEHMKSHSTESFKCEICNKRYLRE
SAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFGHFKEHLRKHTGEKPFECPN
CHERFARNSTLKCHLTACQTGVGAKKGRKKLYECQVCNSVFNSWDQFKDHLVIHTGDKPN
HCTLCDLWFMQGNELRRHLSDAHNISERLVTEEVLSVETRVQTEPVTSMTIIEQVGKVHV
LPLLQVQVDSAQVTVEQVHPDLLQDSQVHDSHMSELPEQVQVSYLEVGRIQTEEGTEVHV
EELHVERVNQMPVEVQTELLEADLDHVTPEIMNQEERESSQADAAEAAREDHEDAEDLET
KPTVDSEAEKAENEDRTALPVLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52739	1.000	1.000	9.025E-103	623	1.000	1.000	P52739.pdb.gz	ZN131_HUMAN Zinc finger protein 131 OS=Homo sapiens OX=9606 GN=ZNF131 PE=1 SV=2
2	AFDB:A0A024R087	0.251	0.263	2.248E-80	589	0.939	0.993	A0A024R087.pdb.gz
3	AFDB:Q24140	0.127	0.121	5.301E-10	664	0.128	0.120	Q24140.pdb.gz	Q24140_DROME Neuron specific zinc finger transcription factor OS=Drosophila melanogaster OX=7227 GN=scrt PE=2 SV=1
4	AFDB:A0A0R4IE83	0.127	0.151	5.386E-9	489	0.128	0.164	A0A0R4IE83.pdb.gz	A0A0R4IE83_DANRE GLIS family zinc finger 2b OS=Danio rerio OX=7955 GN=si:rp71-84k24.2 PE=3 SV=1
5	AFDB:P14404	0.174	0.101	8.485E-8	1232	0.127	0.064	P14404.pdb.gz	MECOM_MOUSE Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2
6	AFDB:A0A0B4K7S6	0.164	0.063	5.919E-7	1965	0.141	0.045	A0A0B4K7S6.pdb.gz	A0A0B4K7S6_DROME Molting defective, isoform D OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1
7	AFDB:Q64318	0.110	0.069	1.717E-6	1117	0.151	0.084	Q64318.pdb.gz	ZEB1_MOUSE Zinc finger E-box-binding homeobox 1 OS=Mus musculus OX=10090 GN=Zeb1 PE=1 SV=1
8	AFDB:B8A5T9	0.186	0.133	2.501E-6	927	0.116	0.078	B8A5T9.pdb.gz
9	AFDB:Q0GGX2	0.120	0.059	4.983E-6	1363	0.140	0.064	Q0GGX2.pdb.gz	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
10	AFDB:Q9H0D2	0.115	0.058	2.880E-5	1346	0.125	0.058	Q9H0D2.pdb.gz	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
11	PDB:3w5kB	0.077	0.260	7.590E-5	110	0.063	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6weoQ	0.056	0.165	1.513	142	0.026	0.113	6weoQ.pdb.gz	The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design.
13	PDB:7uhyC	0.045	0.047	1.715	578	0.026	0.028	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:7oqyY	0.037	0.160	2.070	92	0.037	0.250	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
15	PDB:4kfzB	0.058	0.160	3.209	148	0.040	0.169	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
16	PDB:7dvqM	0.038	0.096	3.209	191	0.043	0.141	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:6ff4t	0.038	0.104	3.417	172	0.037	0.134	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:7ktrE	0.051	0.157	3.638	124	0.029	0.145	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
19	PDB:7uhyA	0.055	0.046	3.638	771	0.045	0.036	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:6ff79	0.050	0.063	3.873	432	0.029	0.042	6ff79.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52739	0.0	1286	623	1.000	1.000	ZN131_HUMAN Zinc finger protein 131 OS=Homo sapiens OX=9606 GN=ZNF131 PE=1 SV=2
2	Q8K3J5	0.0	1206	619	0.941	0.947	ZN131_MOUSE Zinc finger protein 131 OS=Mus musculus OX=10090 GN=Znf131 PE=1 SV=1
3	O43167	6.88e-31	130	697	0.268	0.240	ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens OX=9606 GN=ZBTB24 PE=1 SV=2
4	O43829	1.83e-30	126	449	0.188	0.261	ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=2
5	Q8CGQ6	3.46e-29	123	449	0.170	0.236	Q8CGQ6_RAT Zinc finger protein 161 OS=Rattus norvegicus OX=10116 GN=Zfp161 PE=2 SV=1
6	F1LMU5	1.93e-28	120	449	0.169	0.234	F1LMU5_RAT Zinc finger protein 161 OS=Rattus norvegicus OX=10116 GN=Zfp161 PE=1 SV=2
7	Q08376	1.93e-28	120	449	0.169	0.234	ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus OX=10090 GN=Zbtb14 PE=2 SV=1
8	Q811H0	8.69e-26	112	420	0.172	0.255	ZBT42_MOUSE Zinc finger and BTB domain-containing protein 42 OS=Mus musculus OX=10090 GN=Zbtb42 PE=1 SV=2
9	Q9JMG9	2.03e-24	110	641	0.185	0.179	Q9JMG9_MOUSE POZ (BTB) and AT hook containing zinc finger 1 OS=Mus musculus OX=10090 GN=Patz1 PE=1 SV=1
10	E7FAN3	2.19e-24	110	764	0.103	0.084	E7FAN3_DANRE Zinc finger protein 408 OS=Danio rerio OX=7955 GN=znf408 PE=4 SV=1
11	Q5NBY9	3.32e-24	109	687	0.185	0.167	PATZ1_MOUSE POZ (BTB) and AT hook-containing zinc finger 1 OS=Mus musculus OX=10090 GN=Patz1 PE=1 SV=1
12	Q9HBE1	1.22e-23	108	687	0.185	0.167	PATZ1_HUMAN POZ-, AT hook-, and zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=PATZ1 PE=1 SV=1
13	F1Q8J8	2.15e-23	107	634	0.101	0.099	F1Q8J8_DANRE PR domain zinc finger protein 5 OS=Danio rerio OX=7955 GN=prdm5 PE=4 SV=1
14	Q80X44	2.29e-23	107	710	0.144	0.127	ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus OX=10090 GN=Zbtb24 PE=1 SV=1
15	P41182	2.91e-23	107	706	0.096	0.085	BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens OX=9606 GN=BCL6 PE=1 SV=1
16	Q3URR7	3.34e-23	107	782	0.090	0.072	ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus OX=10090 GN=Zscan10 PE=1 SV=2
17	Q6NSZ9	3.36e-23	106	544	0.104	0.119	ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens OX=9606 GN=ZSCAN25 PE=1 SV=3
18	P41183	3.58e-23	106	707	0.096	0.085	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
19	Q96JL9	2.94e-22	103	665	0.101	0.095	ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens OX=9606 GN=ZNF333 PE=1 SV=3
20	Q4VBD9	2.96e-22	103	706	0.212	0.187	GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus OX=10090 GN=Gzf1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	6.6e-21	86.0	BTB/POZ domain
2	PF09237 GAGA	21	16.5	GAGA factor
3	PF07776 zf-AD	4.4e+02	12.5	Zinc-finger associated domain (zf-AD)
4	PF00096 zf-C2H2	0.00033	32.1	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	1.1e-05	36.9	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	6e+02	11.9	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	1.9	20.1	Zinc-finger double-stranded RNA-binding
8	PF16278 zf-C2HE	5.2e+02	12.5	C2HE / C2H2 / C2HC zinc-binding finger
9	PF13465 zf-H2C2_2	8.7e-11	52.9	Zinc-finger double domain
10	PF12874 zf-met	0.00074	31.0	Zinc-finger of C2H2 type
11	PF17032 zinc_ribbon_15	4.9e+02	12.9	zinc-ribbon family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008961591.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008958015.1	0.772	Belongs to the ubiquitin-conjugating enzyme family.
2	9597.XP_008969842.1	0.717	Chromobox 4
3	9597.XP_003828141.1	0.685	Regulator of chromosome condensation isoform X1
4	9597.XP_003823436.1	0.680	Ubiquitin like with PHD and ring finger domains 2
5	9597.XP_003828150.1	0.679	Belongs to the G-protein coupled receptor 1 family.
6	9597.XP_003820811.1	0.671	Small ubiquitin-related modifier 1
7	9597.XP_003808164.1	0.656	HAUS augmin like complex subunit 4
8	9597.XP_003828139.1	0.630	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
9	9597.XP_003811044.1	0.629	Belongs to the protein kinase superfamily.
10	9597.XP_008964328.1	0.615	SIN3 transcription regulator family member B
11	9597.XP_008961610.1	0.594	WD repeat-containing protein 70
12	9597.XP_003809051.1	0.591	Histatin-3
13	9597.XP_003811039.1	0.583	Coiled-coil domain-containing protein 152
14	9597.XP_003808213.1	0.572	EMSY, BRCA2 interacting transcriptional repressor
15	9597.XP_008958504.1	0.572	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 103 ESTs, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
16	9597.XP_008961533.1	0.552	Zinc finger protein 462 isoform X1
17	9597.XP_003819342.1	0.550	Ubiquitin like with PHD and ring finger domains 1
18	9597.XP_008965425.1	0.541	PHD finger protein 6 isoform X1
19	9597.XP_003816144.1	0.510	HAUS augmin-like complex subunit 5
20	9597.XP_008958403.1	0.509	Belongs to the histone H2B family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.893	heterocyclic compound binding
GO:0097159	0.893	organic cyclic compound binding
GO:0140110	0.889	transcription regulator activity
GO:0003677	0.883	DNA binding
GO:0003700	0.732	DNA-binding transcription factor activity
GO:0001216	0.698	DNA-binding transcription activator activity
GO:0043565	0.549	sequence-specific DNA binding
GO:0000981	0.516	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003690	0.421	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0006355	0.993	regulation of DNA-templated transcription
GO:0006357	0.978	regulation of transcription by RNA polymerase II
GO:0048518	0.907	positive regulation of biological process
GO:0009893	0.865	positive regulation of metabolic process
GO:0010604	0.843	positive regulation of macromolecule metabolic process
GO:0009891	0.807	positive regulation of biosynthetic process
GO:0048522	0.802	positive regulation of cellular process
GO:0045944	0.775	positive regulation of transcription by RNA polymerase II
GO:0009987	0.765	cellular process
GO:0048519	0.419	negative regulation of biological process
GO:0048523	0.387	negative regulation of cellular process
GO:0032502	0.358	developmental process
GO:0010605	0.357	negative regulation of macromolecule metabolic process
GO:0032501	0.355	multicellular organismal process
GO:0031324	0.323	negative regulation of cellular metabolic process
GO:0048856	0.320	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005856	0.792	cytoskeleton
GO:0045111	0.779	intermediate filament cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]