StarFunc result for job id P52742

User Input

>input (658 residues)
MTPGVRVSTDPEQVTFEDVVVGFSQEEWGQLKPAQRTLYRDVMLDTFRLLVSVGHWLPKP
NVISLLEQEAELWAVESRLPQGVYPDLETRPKVKLSVLKQGISEEISNSVILVERFLWDG
LWYCRGEDTEGHWEWSCESLESLAVPVAFTPVKTPVLEQWQRNGFGENISLNPDLPHQPM
TPERQSPHTWGTRGKREKPDLNVLQKTCVKEKPYKCQECGKAFSHSSALIEHHRTHTGER
PYECHECLKGFRNSSALTKHQRIHTGEKPYKCTQCGRTFNQIAPLIQHQRTHTGEKPYEC
SECGKSFSFRSSFSQHERTHTGEKPYECSECGKAFRQSIHLTQHLRIHTGEKPYQCGECG
KAFSHSSSLTKHQRIHTGEKPYECHECGKAFTQITPLIQHQRTHTGEKPYECGECGKAFS
QSTLLTEHRRIHTGEKPYGCNECGKTFSHSSSLSQHERTHTGEKPYECSQCGKAFRQSTH
LTQHQRIHTGEKPYECNDCGKAFSHSSSLTKHQRIHTGEKPYECNQCGRAFSQLAPLIQH
QRIHTGEKPYECNQCGRAFSQSSLLIEHQRIHTKEKPYGCNECGKSFSHSSSLSQHERTH
TGEKPYECHDCGKSFRQSTHLTQHRRIHTGEKPYACRDCGKAFTHSSSLTKHQRTHTG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52742	1.000	1.000	0.000	658	1.000	1.000	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
2	AFDB:Q9P2J8	0.426	0.335	1.192E-64	865	0.512	0.390	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
3	AFDB:Q5MCW4	0.410	0.397	4.484E-63	686	0.505	0.484	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
4	AFDB:Q06732	0.432	0.379	2.222E-62	778	0.514	0.434	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
5	AFDB:P51523	0.397	0.361	2.202E-61	738	0.508	0.453	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
6	AFDB:Q8IYB9	0.586	0.593	3.374E-61	648	0.468	0.475	Q8IYB9.pdb.gz	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
7	AFDB:Q14587	0.402	0.306	5.170E-61	947	0.476	0.331	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
8	AFDB:Q9R164	0.461	0.436	7.511E-61	701	0.456	0.428	Q9R164.pdb.gz	Q9R164_MOUSE Zinc finger protein 111 OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
9	AFDB:Q8TAQ5	0.542	0.520	1.503E-60	688	0.523	0.500	Q8TAQ5.pdb.gz	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
10	AFDB:Q8NDQ6	0.521	0.519	2.183E-60	660	0.473	0.471	Q8NDQ6.pdb.gz	ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens OX=9606 GN=ZNF540 PE=1 SV=1
11	PDB:3w5kB	0.080	0.281	1.100E-4	110	0.062	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7ena4	0.069	0.087	6.932E-1	457	0.070	0.101	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:4fjcE	0.056	0.073	9.546E-1	434	0.058	0.088	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
14	PDB:6lsr0	0.047	0.107	1.246	190	0.044	0.153	6lsr0.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
15	PDB:6vk0C	0.058	0.148	1.387	180	0.023	0.083	6vk0C.pdb.gz
16	PDB:8a5yT	0.052	0.052	1.387	650	0.062	0.063	8a5yT.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex and comparison to apo unphosphorylated and phosphorylated states
17	PDB:8ap8d	0.065	0.113	1.543	270	0.052	0.126	8ap8d.pdb.gz
18	PDB:5c8dE	0.055	0.100	2.774	280	0.035	0.082	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
19	PDB:7nvr3	0.053	0.113	2.774	214	0.047	0.145	7nvr3.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
20	PDB:5lj5t	0.038	0.051	3.256	438	0.023	0.034	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS50	543	604	0.456	0.497	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
2	A0A0U1RQ46	538	609	0.403	0.435	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
3	A2AWF2	531	685	0.442	0.425	A2AWF2_MOUSE Reduced expression 2 OS=Mus musculus OX=10090 GN=Rex2 PE=1 SV=1
4	A6NNF4	530	616	0.398	0.425	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
5	A8K8Y5	549	707	0.450	0.419	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
6	G3V9G6	539	740	0.467	0.415	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
7	O75290	611	641	0.468	0.480	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
8	O75437	575	659	0.479	0.478	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
9	O94892	558	652	0.447	0.451	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
10	P15620	544	580	0.403	0.457	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
11	P15622	548	560	0.444	0.521	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
12	P17014	586	697	0.495	0.468	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
13	P17020	553	682	0.445	0.430	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
14	P17021	581	662	0.474	0.471	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
15	P17027	573	643	0.471	0.482	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
16	P17038	540	809	0.404	0.329	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
17	P17097	558	686	0.492	0.472	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1
18	P35789	612	620	0.486	0.516	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
19	P51523	539	738	0.416	0.371	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
20	P51814	553	821	0.404	0.324	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01352 KRAB	3.3e-19	79.5	KRAB box
2	PF01803 LIM_bind	15	16.5	LIM-domain binding protein
3	PF05458 Siva	3.5e+02	12.3	Cd27 binding protein (Siva)
4	PF01286 XPA_N	4.8e-08	44.2	XPA protein N-terminal
5	PF00096 zf-C2H2	3.8e-92	309.0	Zinc finger, C2H2 type
6	PF16622 zf-C2H2_11	3.8e-15	66.6	zinc-finger C2H2-type
7	PF13894 zf-C2H2_4	1.1e-46	164.5	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	9.3e-21	84.6	C2H2-type zinc finger
9	PF12171 zf-C2H2_jaz	7.2e-12	56.5	Zinc-finger double-stranded RNA-binding
10	PF16278 zf-C2HE	7.5e+02	12.0	C2HE / C2H2 / C2HC zinc-binding finger
11	PF13465 zf-H2C2_2	1.3e-132	438.2	Zinc-finger double domain
12	PF13451 zf-trcl	1.9	19.8	Probable zinc-ribbon domain
13	PF18439 zf_UBZ	9e-09	46.2	Ubiquitin-Binding Zinc Finger
14	PF17032 zinc_ribbon_15	4.1e-09	48.4	zinc-ribbon family
15	PF09723 Zn-ribbon_8	3.5e-16	70.3	Zinc ribbon domain
16	PF13408 Zn_ribbon_recom	4.6e+02	12.7	Recombinase zinc beta ribbon domain
17	PF17283 Zn_ribbon_SprT	0.082	24.2	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441410

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432561	0.764	Histatin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.953	regulation of biological process
GO:0009987	0.909	cellular process
GO:0050794	0.689	regulation of cellular process
GO:0010556	0.607	regulation of macromolecule biosynthetic process
GO:0031326	0.607	regulation of cellular biosynthetic process
GO:0019219	0.606	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.547	regulation of DNA-templated transcription
GO:0048519	0.332	negative regulation of biological process
GO:0032501	0.331	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.988	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]