StarFunc result for job id P52744

User Input

>input (262 residues)
MKRHEMVVAKHSALCSRFAQDLWLEQNIKDSFQKVTLSRYGKYGHKNLQLRKGCKSVDEC
KGHQGGFNGLNQCLKITTSKIFQCNKYVKVMHKFSNSNRHKIRHTENKHFRCKECDKSLC
MLSRLTQHKKIHTRENFYKCEECGKTFNWSTNLSKPKKIHTGEKPYKCEVCGKAFHQSSI
LTKHKIIRTGEKPYKCAHCGKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKH
QIIYTGEEPYKCEECGKAFNLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52744	1.000	1.000	1.735E-48	262	1.000	1.000	P52744.pdb.gz	ZN138_HUMAN Zinc finger protein 138 OS=Homo sapiens OX=9606 GN=ZNF138 PE=1 SV=2
2	AFDB:Q9UII5	0.499	0.202	1.105E-29	783	0.698	0.234	Q9UII5.pdb.gz	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
3	AFDB:Q9H8G1	0.570	0.280	1.931E-29	570	0.637	0.293	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
4	AFDB:Q8IYN0	0.618	0.311	7.104E-29	542	0.630	0.304	Q8IYN0.pdb.gz	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
5	AFDB:P35789	0.533	0.250	3.564E-28	620	0.645	0.273	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
6	AFDB:Q14593	0.374	0.178	4.035E-28	569	0.683	0.315	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
7	AFDB:A6NNF4	0.505	0.198	2.594E-27	738	0.611	0.217	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
8	AFDB:Q03923	0.523	0.255	4.534E-27	595	0.676	0.297	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
9	AFDB:Q03936	0.557	0.266	6.182E-27	586	0.668	0.299	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
10	AFDB:Q8TD23	0.372	0.180	1.150E-26	568	0.649	0.299	Q8TD23.pdb.gz	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
11	PDB:3w5kB	0.154	0.275	4.155E-4	110	0.137	0.327	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6hlqI	0.059	0.109	4.063E-1	111	0.095	0.225	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
13	PDB:7c4cA	0.115	0.097	7.556E-1	332	0.073	0.057	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
14	PDB:7uhyC	0.079	0.042	9.684E-1	578	0.061	0.028	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:5n5yI	0.053	0.126	1.405	99	0.076	0.202	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
16	PDB:6ff47	0.081	0.188	1.405	93	0.069	0.194	6ff47.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:5xncB	0.090	0.074	1.591	354	0.053	0.040	5xncB.pdb.gz	Active site geometry of a novel aminopropyltransferase for biosynthesis of hyperthermophile-specific branched-chain polyamine.
18	PDB:6f40P	0.090	0.094	1.692	246	0.076	0.081	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
19	PDB:5dkaA	0.110	0.237	1.801	96	0.057	0.156	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
20	PDB:5gm6a	0.058	0.098	1.801	123	0.076	0.163	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52744	0.0	536	262	1.000	1.000	ZN138_HUMAN Zinc finger protein 138 OS=Homo sapiens OX=9606 GN=ZNF138 PE=1 SV=2
2	Q03923	2.16e-129	380	595	0.721	0.318	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
3	Q03936	1.45e-123	365	586	0.706	0.316	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
4	Q49A12	1.51e-123	363	536	0.691	0.338	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
5	Q9UII5	4.79e-123	370	783	0.710	0.238	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
6	Q8IYN0	4.11e-120	355	542	0.672	0.325	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
7	Q9H8G1	1.28e-118	352	570	0.668	0.307	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
8	Q2NKJ9	1.43e-118	352	569	0.668	0.308	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
9	P35789	7.04e-118	352	620	0.691	0.292	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
10	Q14593	8.04e-117	347	569	0.691	0.318	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
11	Q5JVG8	2.04e-109	325	444	0.645	0.381	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
12	O75437	1.07e-108	329	659	0.664	0.264	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
13	A6NNF4	6.82e-108	326	616	0.641	0.273	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
14	Q8TD23	2.42e-107	323	568	0.687	0.317	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
15	Q8IYX0	2.91e-107	318	411	0.641	0.409	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
16	Q96JC4	9.56e-102	308	524	0.618	0.309	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
17	Q96H40	5.29e-101	304	463	0.637	0.361	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
18	P17038	3.29e-100	311	809	0.634	0.205	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
19	Q8IYB9	1.37e-96	298	648	0.641	0.259	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
20	Q15928	5.94e-95	288	474	0.599	0.331	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05191 ADK_lid	53	15.2	Adenylate kinase, active site lid
2	PF01722 BolA	0.1	24.3	BolA-like protein
3	PF00130 C1_1	0.16	23.2	Phorbol esters/diacylglycerol binding domain (C1 domain)
4	PF19769 CPxCG_zf	8.2e+02	11.2	CPxCG-related zinc finger
5	PF06397 Desulfoferrod_N	0.44	21.5	Desulfoferrodoxin, N-terminal domain
6	PF03604 DNA_RNApol_7kD	1.3e+02	13.7	DNA directed RNA polymerase, 7 kDa subunit
7	PF09237 GAGA	14	17.1	GAGA factor
8	PF07754 HVO_2753_ZBP	4.2e+02	12.2	Small zinc finger protein HVO_2753-like, Zn-binding pocket
9	PF01286 XPA_N	2.5e-05	35.5	XPA protein N-terminal
10	PF14149 YhfH	2e+02	13.4	YhfH-like protein
11	PF01428 zf-AN1	6.8e+02	11.8	AN1-like Zinc finger
12	PF00096 zf-C2H2	4.5e-17	72.6	Zinc finger, C2H2 type
13	PF16622 zf-C2H2_11	0.57	21.3	zinc-finger C2H2-type
14	PF13894 zf-C2H2_4	4.8e-08	44.2	C2H2-type zinc finger
15	PF13912 zf-C2H2_6	0.058	24.7	C2H2-type zinc finger
16	PF12171 zf-C2H2_jaz	3.3	19.3	Zinc-finger double-stranded RNA-binding
17	PF13465 zf-H2C2_2	2e-32	121.4	Zinc-finger double domain
18	PF16744 zf-RING_15	1.4e+02	14.0	KIAA1045 RING finger
19	PF13451 zf-trcl	15	16.9	Probable zinc-ribbon domain
20	PF18439 zf_UBZ	0.011	26.7	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303533

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432561	0.764	Histatin-3
2	9606.ENSP00000253024	0.508	Transcription intermediary factor 1-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.301	organic cyclic compound binding
GO:1901363	0.300	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0080090	0.989	regulation of primary metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0009889	0.977	regulation of biosynthetic process
GO:0019219	0.976	regulation of nucleobase-containing compound metabolic process
GO:0031327	0.969	negative regulation of cellular biosynthetic process
GO:0045934	0.969	negative regulation of nucleobase-containing compound metabolic process
GO:0051252	0.967	regulation of RNA metabolic process
GO:0010558	0.967	negative regulation of macromolecule biosynthetic process
GO:1903507	0.960	negative regulation of nucleic acid-templated transcription
GO:0045892	0.952	negative regulation of DNA-templated transcription
GO:0009987	0.584	cellular process
GO:0050896	0.432	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.958	intracellular organelle lumen
GO:0031981	0.897	nuclear lumen
GO:0005576	0.853	extracellular region
GO:0005615	0.699	extracellular space
GO:0005654	0.566	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]