StarFunc result for job id P52746

User Input

>input (1687 residues)
MTDPLLDSQPASSTGEMDGLCPELLLIPPPLSNRGILGPVQSPCPSRDPAPIPTEPGCLL
VEATATEEGPGNMEIIVETVAGTLTPGAPGETPAPKLPPGEREPSQEAGTPLPGQETAEE
ENVEKEEKSDTQKDSQKAVDKGQGAQRLEGDVVSGTESLFKTHMCPECKRCFKKRTHLVE
HLHLHFPDPSLQCPNCQKFFTSKSKLKTHLLRELGEKAHHCPLCHYSAVERNALNRHMAS
MHEDISNFYSDTYACPVCREEFRLSQALKEHLKSHTAAAAAEPLPLRCFQEGCSYAAPDR
KAFIKHLKETHGVRAVECRHHSCPMLFATAEAMEAHHKSHYAFHCPHCDFACSNKHLFRK
HKKQGHPGSEELRCTFCPFATFNPVAYQDHVGKMHAHEKIHQCPECNFATAHKRVLIRHM
LLHTGEKPHKCELCDFTCRDVSYLSKHMLTHSNTKDYMCTECGYVTKWKHYLRVHMRKHA
GDLRYQCNQCSYRCHRADQLSSHKLRHQGKSLMCEVCAFACKRKYELQKHMASQHHPGTP
APLYPCHYCSYQSRHKQAVLSHENCKHTRLREFHCALCDYRTFSNTTLLFHKRKAHGYVP
GDQAWQLRYASQEPEGAMQGPTPPPDSEPSNQLSARPEGPGHEPGTVVDPSLDQALPEMS
EEVNTGRQEGSEAPHGGDLGGSPSPAEVEEGSCTLHLEALGVELESVTEPPLEEVTETAP
MEFRPLGLEGPDGLEGPELSSFEGIGTSDLSAEENPLLEKPVSEPSTNPPSLEEAPNNWV
GTFKTTPPAETAPLPPLPESESLLKALRRQDKEQAEALVLEGRVQMVVIQGEGRAFRCPH
CPFITRREKALNLHSRTGCQGRREPLLCPECGASFKQQRGLSTHLLKKCPVLLRKNKGLP
RPDSPIPLQPVLPGTQASEDTESGKPPPASQEAELLLPKDAPLELPREPEETEEPLATVS
GSPVPPAGNSLPTEAPKKHCFDPVPPAGNSSPTEAPKKHHLDPVPPAGNSSPTEALKKHR
FEQGKFHCNSCPFLCSRLSSITSHVAEGCRGGRGGGGKRGTPQTQPDVSPLSNGDSAPPK
NGSTESSSGDGDTVLVQKQKGARFSCPTCPFSCQQERALRTHQIRGCPLEESGELHCSLC
PFTAPAATALRLHQKRRHPTAAPARGPRPHLQCGDCGFTCKQSRCMQQHRRLKHEGVKPH
QCPFCDFSTTRRYRLEAHQSRHTGIGRIPCSSCPQTFGTNSKLRLHRLRVHDKTPTHFCP
LCDYSGYLRHDITRHVNSCHQGTPAFACSQCEAQFSSETALKQHALRRHPEPAQPAPGSP
AETTEGPLHCSRCGLLCPSPASLRGHTRKQHPRLECGACQEAFPSRLALDEHRRQQHFSH
RCQLCDFAARERVGLVKHYLEQHEETSAAVAASDGDGDAGQPPLHCPFCDFTCRHQLVLD
HHVKGHGGTRLYKCTDCAYSTKNRQKITWHSRIHTGEKPYHCHLCPYACADPSRLKYHMR
IHKEERKYLCPECGYKCKWVNQLKYHMTKHTGLKPYQCPECEYCTNRADALRVHQETRHR
EARAFMCEQCGKAFKTRFLLRTHLRKHSEAKPYVCNVCHRAFRWAAGLRHHALTHTDRHP
FFCRLCNYKAKQKFQVVKHVRRHHPDQADPNQGVGKDPTTPTVHLHDVQLEDPSPPAPAA
PHTGPEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13105	0.099	0.181	2.084E-17	803	0.084	0.177	Q13105.pdb.gz	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
2	AFDB:Q5EXX3	0.047	0.061	6.868E-15	1203	0.108	0.151	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
3	AFDB:O54963	0.106	0.161	8.531E-15	1069	0.121	0.191	O54963.pdb.gz	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
4	AFDB:Q3URU2	0.054	0.057	1.181E-14	1571	0.142	0.152	Q3URU2.pdb.gz	PEG3_MOUSE Paternally-expressed gene 3 protein OS=Mus musculus OX=10090 GN=Peg3 PE=1 SV=1
5	AFDB:Q9H5H4	0.122	0.339	1.725E-14	540	0.081	0.254	Q9H5H4.pdb.gz	ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2
6	AFDB:A0A2R8QUZ1	0.066	0.127	1.031E-13	809	0.081	0.168	A0A2R8QUZ1.pdb.gz
7	AFDB:A0A1W2PQA1	0.078	0.117	1.214E-11	1069	0.115	0.181	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
8	AFDB:M9PG92	0.086	0.161	3.050E-11	794	0.086	0.183	M9PG92.pdb.gz	M9PG92_DROME Jim, isoform G OS=Drosophila melanogaster OX=7227 GN=jim PE=4 SV=1
9	AFDB:A0A0B4K7S6	0.093	0.080	1.317E-10	1965	0.176	0.151	A0A0B4K7S6.pdb.gz	A0A0B4K7S6_DROME Molting defective, isoform D OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1
10	AFDB:A0A0R4IBX8	0.084	0.104	1.925E-10	1267	0.129	0.172	A0A0R4IBX8.pdb.gz
11	PDB:3w5kB	0.039	0.317	5.301E-2	110	0.018	0.273	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.024	0.234	5.751E-1	96	0.009	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:5tteB	0.032	0.075	7.961E-1	442	0.030	0.115	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
14	PDB:6wjvA	0.032	0.029	9.887E-1	1951	0.014	0.012	6wjvA.pdb.gz
15	PDB:5apny	0.028	0.117	1.102	211	0.017	0.137	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:7pmkQ	0.018	0.026	1.794	766	0.013	0.029	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
17	PDB:6o9lQ	0.025	0.060	2.111	430	0.033	0.130	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
18	PDB:4r8pL	0.023	0.092	2.622	254	0.014	0.091	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
19	PDB:3mhsA	0.036	0.089	2.922	455	0.015	0.055	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
20	PDB:7uhyA	0.015	0.030	3.257	771	0.012	0.026	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TYW1	8.71e-50	196	1059	0.100	0.159	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
2	Q96MU6	1.34e-48	189	729	0.088	0.203	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
3	Q6ECI4	2.66e-47	184	717	0.087	0.204	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
4	Q8BLA2	8.24e-47	180	578	0.089	0.260	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
5	Q7TMN8	9.04e-47	180	578	0.089	0.260	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
6	Q9P2J8	3.72e-46	183	865	0.094	0.184	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
7	Q8TAQ5	7.84e-46	179	688	0.090	0.221	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
8	Q05481	1.40e-45	183	1191	0.100	0.142	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
9	P51523	1.56e-45	179	738	0.095	0.217	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
10	Q8IYB9	1.76e-45	178	648	0.087	0.225	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
11	Q49A12	2.08e-45	175	536	0.079	0.248	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
12	E9QAG8	3.42e-45	174	526	0.083	0.266	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1
13	Q03923	3.86e-45	176	595	0.079	0.224	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
14	Q9Y2P0	1.45e-44	173	537	0.084	0.264	ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens OX=9606 GN=ZNF835 PE=1 SV=2
15	Q8NDQ6	1.47e-44	175	660	0.084	0.215	ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens OX=9606 GN=ZNF540 PE=1 SV=1
16	P17038	2.69e-44	176	809	0.091	0.190	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
17	Q5MCW4	3.09e-44	175	686	0.084	0.207	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
18	E9Q981	3.15e-44	174	636	0.083	0.220	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
19	A0A087WSF4	3.77e-44	174	635	0.083	0.220	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
20	Q9UJW7	4.23e-44	176	825	0.081	0.165	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	4.8e-24	94.6	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	2.7e-12	57.4	C2H2-type zinc finger
3	PF13912 zf-C2H2_6	0.044	25.1	C2H2-type zinc finger
4	PF13465 zf-H2C2_2	7.4e-45	160.7	Zinc-finger double domain
5	PF13909 zf-H2C2_5	1.3e-17	74.5	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398798

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363270	0.765	RUN and FYVE domain containing 4
2	9606.ENSP00000432561	0.764	Histatin-3
3	9606.ENSP00000413908	0.735	Mitochondrial chaperone BCS1
4	9606.ENSP00000304250	0.733	Cyclin-dependent kinase 5 activator 2
5	9606.ENSP00000295709	0.722	Serine/threonine-protein kinase 36
6	9606.ENSP00000415027	0.711	Uncharacterized protein C16orf96
7	9606.ENSP00000300778	0.709	Olfactory receptor 51Q1
8	9606.ENSP00000295759	0.699	Beta-galactosidase-1-like protein
9	9606.ENSP00000233336	0.692	Tubulin--tyrosine ligase
10	9606.ENSP00000386272	0.638	Putative sodium-coupled neutral amino acid transporter 11
11	9606.ENSP00000332325	0.633	Zinc finger protein 703
12	9606.ENSP00000254579	0.598	Dynein heavy chain domain 1
13	9606.ENSP00000340776	0.590	Cilia- and flagella-associated protein 65
14	9606.ENSP00000371686	0.563	Doublesex- and mab-3-related transcription factor 2
15	9606.ENSP00000303777	0.544	Testis-expressed protein 13B
16	9606.ENSP00000478104	0.544	Vacuolar protein sorting 13 homolog D
17	9606.ENSP00000400892	0.541	Protein TESPA1
18	9606.ENSP00000356529	0.535	Regulator of G-protein signaling 16
19	9606.ENSP00000333640	0.519	Eyes absent homolog 2
20	9606.ENSP00000260505	0.513	Tubulin polyglutamylase TTLL7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.973	heterocyclic compound binding
GO:0097159	0.973	organic cyclic compound binding
GO:0003676	0.955	nucleic acid binding
GO:0003677	0.933	DNA binding
GO:0043565	0.916	sequence-specific DNA binding
GO:0000981	0.912	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.721	sequence-specific double-stranded DNA binding
GO:0000976	0.569	transcription cis-regulatory region binding
GO:0000977	0.506	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.472	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0009987	0.955	cellular process
GO:0010556	0.939	regulation of macromolecule biosynthetic process
GO:0051252	0.925	regulation of RNA metabolic process
GO:0031326	0.843	regulation of cellular biosynthetic process
GO:0010468	0.839	regulation of gene expression
GO:0006355	0.541	regulation of DNA-templated transcription
GO:0071840	0.518	cellular component organization or biogenesis
GO:0016043	0.440	cellular component organization
GO:0048518	0.364	positive regulation of biological process
GO:0008152	0.337	metabolic process
GO:0048522	0.324	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.987	nuclear lumen
GO:0005654	0.957	nucleoplasm
GO:0005737	0.750	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]