StarFunc result for job id P52758

User Input

>input (137 residues)
MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALK
NMGEILKAAGCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSR
IEIEAVAIQGPLTTASL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52758	1.000	1.000	3.221E-30	137	1.000	1.000	P52758.pdb.gz	RIDA_HUMAN 2-iminobutanoate/2-iminopropanoate deaminase OS=Homo sapiens OX=9606 GN=RIDA PE=1 SV=1
2	AFDB:P52759	0.976	0.976	1.395E-27	137	0.876	0.876	P52759.pdb.gz	RIDA_RAT 2-iminobutanoate/2-iminopropanoate deaminase OS=Rattus norvegicus OX=10116 GN=Rida PE=1 SV=3
3	PDB:1oniA	0.959	0.966	1.784E-27	136	0.993	1.000	1oniA.pdb.gz
4	AFDB:P52760	0.969	0.984	5.910E-26	135	0.803	0.815	P52760.pdb.gz	RIDA_MOUSE 2-iminobutanoate/2-iminopropanoate deaminase OS=Mus musculus OX=10090 GN=Rida PE=1 SV=3
5	PDB:1qahA	0.940	0.975	7.246E-25	132	0.847	0.879	1qahA.pdb.gz
6	AFDB:Q9V3W0	0.982	0.975	4.209E-21	138	0.467	0.464	Q9V3W0.pdb.gz	UK114_DROME RutC family protein UK114 OS=Drosophila melanogaster OX=7227 GN=UK114 PE=2 SV=1
7	AFDB:Q94JQ4	0.909	0.668	1.346E-20	187	0.504	0.369	Q94JQ4.pdb.gz	RIDA_ARATH Reactive Intermediate Deaminase A, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RIDA PE=1 SV=1
8	AFDB:A0A1J1DL12	0.903	0.966	6.921E-19	128	0.409	0.438	A0A1J1DL12.pdb.gz	RIDA_DERFA 2-iminobutanoate/2-iminopropanoate deaminase OS=Dermatophagoides farinae OX=6954 GN=MAG133 PE=1 SV=1
9	AFDB:P37552	0.879	0.962	1.408E-18	125	0.401	0.440	P37552.pdb.gz	RIDA_BACSU 2-iminobutanoate/2-iminopropanoate deaminase OS=Bacillus subtilis (strain 168) OX=224308 GN=ridA PE=1 SV=3
10	AFDB:Q8U308	0.899	0.977	9.777E-18	126	0.431	0.468	Q8U308.pdb.gz	RIDA_PYRFU 2-iminobutanoate/2-iminopropanoate deaminase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=ridA PE=1 SV=1
11	AFDB:P40037	0.911	0.966	1.989E-17	129	0.350	0.372	P40037.pdb.gz	HMF1_YEAST Protein HMF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMF1 PE=1 SV=1
12	PDB:1qd9A	0.863	0.952	7.150E-17	124	0.401	0.444	1qd9A.pdb.gz
13	AFDB:P40185	0.910	0.861	7.240E-17	145	0.321	0.303	P40185.pdb.gz	MMF1_YEAST Protein MMF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MMF1 PE=1 SV=1
14	PDB:2uyjA	0.877	0.937	2.439E-16	128	0.387	0.414	2uyjA.pdb.gz
15	PDB:1jd1A	0.886	0.961	7.314E-16	126	0.350	0.381	1jd1A.pdb.gz
16	PDB:1qu9A	0.861	0.927	7.314E-16	127	0.416	0.449	1qu9A.pdb.gz
17	PDB:3quwA	0.882	0.964	8.322E-16	125	0.321	0.352	3quwA.pdb.gz
18	PDB:1pf5A	0.801	0.841	2.022E-10	130	0.226	0.238	1pf5A.pdb.gz
19	PDB:3i7tA	0.757	0.873	4.115E-10	118	0.248	0.288	3i7tA.pdb.gz
20	PDB:4bpsA	0.752	0.330	5.010E-7	331	0.190	0.079	4bpsA.pdb.gz	Mechanistic Implications for the Chorismatase Fkbo Based on the Crystal Structure.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52758	1.56e-97	278	137	1.000	1.000	RIDA_HUMAN 2-iminobutanoate/2-iminopropanoate deaminase OS=Homo sapiens OX=9606 GN=RIDA PE=1 SV=1
2	P52759	5.13e-86	249	137	0.876	0.876	RIDA_RAT 2-iminobutanoate/2-iminopropanoate deaminase OS=Rattus norvegicus OX=10116 GN=Rida PE=1 SV=3
3	P52760	1.20e-79	233	135	0.803	0.815	RIDA_MOUSE 2-iminobutanoate/2-iminopropanoate deaminase OS=Mus musculus OX=10090 GN=Rida PE=1 SV=3
4	Q94JQ4	1.47e-46	150	187	0.489	0.358	RIDA_ARATH Reactive Intermediate Deaminase A, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RIDA PE=1 SV=1
5	Q9V3W0	1.14e-44	144	138	0.467	0.464	UK114_DROME RutC family protein UK114 OS=Drosophila melanogaster OX=7227 GN=UK114 PE=2 SV=1
6	A0A1J1DL12	2.96e-39	130	128	0.409	0.438	RIDA_DERFA 2-iminobutanoate/2-iminopropanoate deaminase OS=Dermatophagoides farinae OX=6954 GN=MAG133 PE=1 SV=1
7	Q8U308	2.09e-36	123	126	0.431	0.468	RIDA_PYRFU 2-iminobutanoate/2-iminopropanoate deaminase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=ridA PE=1 SV=1
8	P37552	2.50e-35	120	125	0.401	0.440	RIDA_BACSU 2-iminobutanoate/2-iminopropanoate deaminase OS=Bacillus subtilis (strain 168) OX=224308 GN=ridA PE=1 SV=3
9	P0AGL2	3.98e-33	115	129	0.387	0.411	TDCF_ECOLI Putative reactive intermediate deaminase TdcF OS=Escherichia coli (strain K12) OX=83333 GN=tdcF PE=1 SV=1
10	P0AF93	8.73e-32	111	128	0.423	0.453	RIDA_ECOLI 2-iminobutanoate/2-iminopropanoate deaminase OS=Escherichia coli (strain K12) OX=83333 GN=ridA PE=1 SV=2
11	Q7CP78	1.44e-31	110	128	0.416	0.445	RIDA_SALTY 2-iminobutanoate/2-iminopropanoate deaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=ridA PE=1 SV=1
12	P40185	1.74e-23	90.9	145	0.321	0.303	MMF1_YEAST Protein MMF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MMF1 PE=1 SV=1
13	P40037	8.21e-23	88.6	129	0.307	0.326	HMF1_YEAST Protein HMF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMF1 PE=1 SV=1
14	O43003	4.94e-22	87.8	162	0.307	0.259	MMF1_SCHPO Protein mmf1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mmf1 PE=3 SV=1
15	P0AFQ5	5.01e-12	60.8	128	0.204	0.219	RUTC_ECOLI 3-aminoacrylate deaminase RutC OS=Escherichia coli (strain K12) OX=83333 GN=rutC PE=1 SV=1
16	P83145	1.62e-09	52.0	39	0.212	0.744	UK114_CHICK Ribonuclease UK114 (Fragments) OS=Gallus gallus OX=9031 PE=1 SV=2
17	Q9USQ7	3.08e-07	50.1	606	0.255	0.058	DPH6_SCHPO Diphthine--ammonia ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug71 PE=1 SV=1
18	O07205	2.57e-06	46.2	142	0.248	0.239	O07205_MYCTO RidA family protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2777.1 PE=1 SV=1
19	P0AEB7	0.001	38.5	114	0.182	0.219	YOAB_ECOLI RutC family protein YoaB OS=Escherichia coli (strain K12) OX=83333 GN=yoaB PE=3 SV=1
20	P39332	0.007	36.6	131	0.204	0.214	YJGH_ECOLI RutC family protein YjgH OS=Escherichia coli (strain K12) OX=83333 GN=yjgH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03262 Corona_6B_7B	99	13.8	Coronavirus 6B/7B protein
2	PF17056 KRE1	5.4e+02	11.7	Killer toxin-resistance protein 1
3	PF01042 Ribonuc_L-PSP	2.4e-38	142.3	Endoribonuclease L-PSP

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254878

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387164	0.788	Probable serine carboxypeptidase CPVL
2	9606.ENSP00000359127	0.772	Diphthine methyl ester synthase
3	9606.ENSP00000277540	0.765	Diphthine methyltransferase
4	9606.ENSP00000391481	0.737	Transketolase
5	9606.ENSP00000419599	0.736	DPH3 homolog
6	9606.ENSP00000362918	0.730	YTH domain-containing family protein 2
7	9606.ENSP00000280605	0.716	Transketolase-like protein 2
8	9606.ENSP00000265881	0.713	Oligoribonuclease, mitochondrial
9	9606.ENSP00000318868	0.694	Serine hydroxymethyltransferase, cytosolic
10	9606.ENSP00000256538	0.680	Diphthine--ammonia ligase
11	9606.ENSP00000444788	0.678	Tryptophan 2,3-dioxygenase
12	9606.ENSP00000371345	0.659	Methyltransferase-like protein 22
13	9606.ENSP00000263083	0.649	2-(3-amino-3-carboxypropyl)histidine synthase subunit 1
14	9606.ENSP00000255108	0.645	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2
15	9606.ENSP00000301457	0.640	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
16	9606.ENSP00000444433	0.624	Protein SCO2 homolog, mitochondrial
17	9606.ENSP00000294904	0.621	RNA-binding motif, single-stranded-interacting protein 1
18	9606.ENSP00000247001	0.618	SURP and G-patch domain-containing protein 1
19	9606.ENSP00000418401	0.616	Signal recognition particle receptor subunit beta
20	9606.ENSP00000258105	0.613	Mitochondrial ribosomal protein L53

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019239	0.999	deaminase activity
GO:0005515	0.998	protein binding
GO:0097159	0.963	organic cyclic compound binding
GO:1901363	0.954	heterocyclic compound binding
GO:0003676	0.873	nucleic acid binding
GO:0003723	0.799	RNA binding
GO:0042802	0.598	identical protein binding
GO:0003729	0.587	mRNA binding
GO:0120242	0.554	2-iminobutanoate deaminase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0071704	0.984	organic substance metabolic process
GO:0044237	0.978	cellular metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0044238	0.972	primary metabolic process
GO:0006807	0.966	nitrogen compound metabolic process
GO:0031323	0.965	regulation of cellular metabolic process
GO:0051246	0.936	regulation of protein metabolic process
GO:0034248	0.895	regulation of amide metabolic process
GO:0010468	0.813	regulation of gene expression
GO:0048519	0.796	negative regulation of biological process
GO:0010605	0.792	negative regulation of macromolecule metabolic process
GO:0031326	0.769	regulation of cellular biosynthetic process
GO:1901564	0.755	organonitrogen compound metabolic process
GO:0010556	0.746	regulation of macromolecule biosynthetic process
GO:0046483	0.602	heterocycle metabolic process
GO:0044281	0.549	small molecule metabolic process
GO:0043170	0.506	macromolecule metabolic process
GO:2000112	0.499	regulation of cellular macromolecule biosynthetic process
GO:1901360	0.488	organic cyclic compound metabolic process
GO:0006725	0.483	cellular aromatic compound metabolic process
GO:0034641	0.472	cellular nitrogen compound metabolic process
GO:0009056	0.413	catabolic process
GO:0006520	0.406	amino acid metabolic process
GO:0010608	0.390	post-transcriptional regulation of gene expression
GO:0006417	0.384	regulation of translation
GO:1901575	0.369	organic substance catabolic process
GO:0051248	0.349	negative regulation of protein metabolic process
GO:0048523	0.338	negative regulation of cellular process
GO:0006139	0.313	nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0005634	0.990	nucleus
GO:0005576	0.947	extracellular region
GO:0070013	0.917	intracellular organelle lumen
GO:0070062	0.890	extracellular exosome
GO:0005739	0.834	mitochondrion
GO:0031981	0.437	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.-.-	0.999	Acting on carbon-nitrogen bonds, other than peptide bonds.
RHEA:39975	0.554	2-iminobutanoate + H2O = 2-oxobutanoate + NH4(+)

[back to server]