StarFunc result for job id P52788

User Input

>input (366 residues)
MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFAN
LRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAI
DRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRA
IMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDV
LDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILD
LSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTV
WKKAKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52788	1.000	1.000	1.189E-84	366	1.000	1.000	P52788.pdb.gz	SPSY_HUMAN Spermine synthase OS=Homo sapiens OX=9606 GN=SMS PE=1 SV=2
2	PDB:3c6kD	0.946	0.994	7.694E-73	348	0.945	0.994	3c6kD.pdb.gz	Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
3	AFDB:A2BIX4	0.567	0.701	6.525E-21	292	0.189	0.236	A2BIX4.pdb.gz	SPEE1_HYPBU Polyamine aminopropyltransferase 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) OX=415426 GN=speE1 PE=1 SV=1
4	AFDB:Q5JFG9	0.552	0.691	9.614E-20	288	0.169	0.215	Q5JFG9.pdb.gz	SPEE_THEKO Polyamine aminopropyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=speE PE=1 SV=1
5	PDB:1mjfA	0.542	0.717	1.078E-19	271	0.189	0.255	1mjfA.pdb.gz
6	AFDB:Q8ZXM4	0.570	0.707	1.150E-19	291	0.172	0.216	Q8ZXM4.pdb.gz	SPEE_PYRAE Polyamine aminopropyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2) OX=178306 GN=speE PE=1 SV=1
7	AFDB:Q8U4G1	0.556	0.712	1.551E-19	281	0.175	0.228	Q8U4G1.pdb.gz	SPEE_PYRFU Polyamine aminopropyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=speE PE=1 SV=1
8	AFDB:Q5SK28	0.535	0.616	7.791E-19	314	0.161	0.188	Q5SK28.pdb.gz	SPEE_THET8 Polyamine aminopropyltransferase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=speE PE=1 SV=1
9	AFDB:Q12455	0.529	0.638	9.322E-19	300	0.158	0.193	Q12455.pdb.gz	SPSY_YEAST Spermine synthase SPE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPE4 PE=1 SV=1
10	AFDB:Q9HV34	0.564	0.589	9.322E-19	349	0.150	0.158	Q9HV34.pdb.gz	SPEE2_PSEAE Polyamine aminopropyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=speE2 PE=3 SV=1
11	AFDB:Q9WZC2	0.550	0.671	9.322E-19	296	0.142	0.176	Q9WZC2.pdb.gz	SPEE_THEMA Polyamine aminopropyltransferase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=speE PE=1 SV=1
12	AFDB:Q6FWB8	0.550	0.678	1.184E-18	293	0.164	0.205	Q6FWB8.pdb.gz	Q6FWB8_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SPE3 PE=3 SV=1
13	PDB:1jq3A	0.547	0.667	3.454E-18	295	0.142	0.176	1jq3A.pdb.gz	The crystal structure of spermidine synthase with a multisubstrate adduct inhibitor.
14	PDB:3o4fC	0.514	0.649	2.636E-17	284	0.150	0.194	3o4fC.pdb.gz
15	PDB:2pt6A	0.543	0.695	4.515E-17	281	0.158	0.206	2pt6A.pdb.gz	Crystal structure of Plasmodium falciparum spermidine synthase in complex with the substrate decarboxylated S-adenosylmethionine and the potent inhibitors 4MCHA and AdoDATO.
16	PDB:2o06A	0.522	0.633	6.088E-17	297	0.169	0.209	2o06A.pdb.gz	Structure and mechanism of spermidine synthases.
17	PDB:6o65B	0.533	0.652	2.137E-16	294	0.161	0.201	6o65B.pdb.gz	Spermidine Synthase (SPDS) Undergoes Concerted Structural Rearrangements Upon Ligand Binding - A Case Study of the Two SPDS Isoforms FromArabidopsis thaliana.
18	PDB:3anxB	0.526	0.607	2.881E-16	313	0.164	0.192	3anxB.pdb.gz	Crystal structures and enzymatic properties of a triamine/agmatine aminopropyltransferase from Thermus thermophilus
19	PDB:3c0kA	0.378	0.354	3.427E-10	395	0.142	0.132	3c0kA.pdb.gz
20	PDB:3v97B	0.394	0.244	3.638E-10	641	0.093	0.053	3v97B.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F7EX49	0.0	699	383	0.967	0.924	F7EX49_RAT Spermine synthase OS=Rattus norvegicus OX=10116 GN=Sms PE=3 SV=1
2	P52788	0.0	754	366	1.000	1.000	SPSY_HUMAN Spermine synthase OS=Homo sapiens OX=9606 GN=SMS PE=1 SV=2
3	P97355	0.0	706	366	0.962	0.962	SPSY_MOUSE Spermine synthase OS=Mus musculus OX=10090 GN=Sms PE=1 SV=1
4	Q3MIE9	0.0	709	366	0.967	0.967	Q3MIE9_RAT Spermine synthase OS=Rattus norvegicus OX=10116 GN=Sms PE=2 SV=1
5	X2JGL7	3.55e-92	285	458	0.426	0.341	X2JGL7_DROME Spermine synthase, isoform D OS=Drosophila melanogaster OX=7227 GN=Sms PE=1 SV=1
6	A2BIX4	8.31e-15	76.3	292	0.178	0.223	SPEE1_HYPBU Polyamine aminopropyltransferase 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) OX=415426 GN=speE1 PE=1 SV=1
7	Q09741	2.74e-12	68.9	298	0.156	0.191	SPEE_SCHPO Spermidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.07c PE=3 SV=1
8	F1R3G8	3.01e-12	68.6	289	0.120	0.152	F1R3G8_DANRE Spermidine synthase OS=Danio rerio OX=7955 GN=fa18b03 PE=1 SV=1
9	P09158	3.76e-12	68.6	288	0.120	0.153	SPEE_ECOLI Polyamine aminopropyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=speE PE=1 SV=2
10	Q12455	4.28e-12	68.6	300	0.158	0.193	SPSY_YEAST Spermine synthase SPE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPE4 PE=1 SV=1
11	Q6FWB8	6.41e-12	67.8	293	0.161	0.201	Q6FWB8_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SPE3 PE=3 SV=1
12	G5EAU1	6.66e-12	67.8	292	0.153	0.192	G5EAU1_EMENI SPEE_NEUCR Spermidine synthase (Putrescine aminopropyltransferase) (SPDSY)Spermidine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00687 PE=3 SV=1
13	Q99MI5	9.97e-12	67.4	302	0.161	0.195	Q99MI5_RAT Spermidine synthase OS=Rattus norvegicus OX=10116 GN=Srm PE=1 SV=1
14	M0RCX8	1.00e-11	67.4	321	0.189	0.215	M0RCX8_RAT Spermidine synthase OS=Rattus norvegicus OX=10116 GN=Srm PE=1 SV=1
15	Q7SY20	1.07e-11	67.0	289	0.117	0.149	Q7SY20_DANRE Zgc:63600 OS=Danio rerio OX=7955 GN=zgc:63600 PE=2 SV=1
16	Q64674	1.10e-11	67.0	302	0.161	0.195	SPEE_MOUSE Spermidine synthase OS=Mus musculus OX=10090 GN=Srm PE=1 SV=1
17	P19623	1.39e-11	67.0	302	0.161	0.195	SPEE_HUMAN Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1
18	Q8U4G1	1.50e-11	66.6	281	0.180	0.235	SPEE_PYRFU Polyamine aminopropyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=speE PE=1 SV=1
19	Q12074	1.82e-11	66.2	293	0.153	0.191	SPEE_YEAST Spermidine synthase SPE3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPE3 PE=1 SV=1
20	Q8ZXM4	2.82e-11	65.9	291	0.161	0.203	SPEE_PYRAE Polyamine aminopropyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2) OX=178306 GN=speE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01861 BpsA_C	17	16.1	Branched-chain polyamine synthase A C-terminal domain
2	PF05175 MTS	5.8e+02	11.5	Methyltransferase small domain
3	PF01564 Spermine_synth	1.1e-50	183.1	Spermine/spermidine synthase domain
4	PF17284 Spermine_synt_N	5e-15	66.4	Spermidine synthase tetramerisation domain
5	PF17950 SpmSyn_N	3.1e-46	166.8	S-adenosylmethionine decarboxylase N -terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385746

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357880	0.994	S-adenosylmethionine decarboxylase proenzyme
2	9606.ENSP00000369519	0.968	S-methyl-5'-thioadenosine phosphorylase
3	9606.ENSP00000366156	0.947	Spermidine synthase
4	9606.ENSP00000234111	0.903	Ornithine decarboxylase
5	9606.ENSP00000264668	0.848	Methionine synthase reductase
6	9606.ENSP00000278060	0.837	Peroxisomal N(1)-acetyl-spermine/spermidine oxidase
7	9606.ENSP00000294517	0.831	Antizyme inhibitor 2
8	9606.ENSP00000478305	0.826	Spermine oxidase
9	9606.ENSP00000273920	0.800	Enolase-phosphatase E1
10	9606.ENSP00000368682	0.784	Phosphate-regulating neutral endopeptidase
11	9606.ENSP00000368572	0.781	Diamine acetyltransferase 1
12	9606.ENSP00000357838	0.722	Ornithine aminotransferase, mitochondrial
13	9606.ENSP00000361471	0.722	Argininosuccinate synthase
14	9606.ENSP00000448228	0.722	Spermatogenesis-associated serine-rich protein 2
15	9606.ENSP00000261783	0.713	Arginase-2, mitochondrial
16	9606.ENSP00000313454	0.693	Ubiquitin-like modifier-activating enzyme 6
17	9606.ENSP00000375836	0.690	Vigilin
18	9606.ENSP00000337180	0.684	Antizyme inhibitor 1
19	9606.ENSP00000349446	0.678	Arginase-1
20	9606.ENSP00000364986	0.673	Agmatinase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016768	1.000	spermine synthase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0009987	0.987	cellular process
GO:0044237	0.984	cellular metabolic process
GO:0009308	0.983	amine metabolic process
GO:0006576	0.955	biogenic amine metabolic process
GO:0006595	0.950	polyamine metabolic process
GO:0009058	0.791	biosynthetic process
GO:1901576	0.749	organic substance biosynthetic process
GO:0044249	0.744	cellular biosynthetic process
GO:1901566	0.729	organonitrogen compound biosynthetic process
GO:0034641	0.714	cellular nitrogen compound metabolic process
GO:0044271	0.636	cellular nitrogen compound biosynthetic process
GO:0044238	0.518	primary metabolic process
GO:0042401	0.447	biogenic amine biosynthetic process
GO:0006596	0.436	polyamine biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0070062	0.996	extracellular exosome
GO:0043231	0.791	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19973	1.000	S-adenosyl 3-(methylsulfanyl)propylamine + spermidine = H(+) + S-methyl-5'-thioadenosine + spermine
EC:2.5.1.22	1.000	spermine synthase.

[back to server]