StarFunc result for job id P52789

User Input

>input (917 residues)
MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAA
VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
GSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV
EGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYME
EMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLG
LDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKH
PHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLS
HDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV
LLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVG
TMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDD
FRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG
IFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKG
AALITAVACRIREAGQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1qhaA	0.809	0.821	0.000	903	0.719	0.730	1qhaA.pdb.gz	Binding of non-catalytic ATP to human hexokinase I highlights the structural components for enzyme-membrane association control.
2	PDB:2nztB	0.884	0.932	0.000	867	0.941	0.995	2nztB.pdb.gz	The catalytic inactivation of the N-half of human hexokinase 2 and structural and biochemical characterization of its mitochondrial conformation.
3	PDB:5hfuB	0.810	0.826	0.000	897	0.976	0.998	5hfuB.pdb.gz	Discovery of a Novel 2,6-Disubstituted Glucosamine Series of Potent and Selective Hexokinase 2 Inhibitors.
4	PDB:5hg1A	0.818	0.861	0.000	867	0.943	0.998	5hg1A.pdb.gz	Discovery of a Novel 2,6-Disubstituted Glucosamine Series of Potent and Selective Hexokinase 2 Inhibitors.
5	AFDB:O08528	0.998	0.998	0.000	917	0.942	0.942	O08528.pdb.gz	HXK2_MOUSE Hexokinase-2 OS=Mus musculus OX=10090 GN=Hk2 PE=1 SV=1
6	AFDB:P17710	0.866	0.819	0.000	974	0.708	0.666	P17710.pdb.gz	HXK1_MOUSE Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3
7	AFDB:Q2TB90	0.939	0.939	0.000	917	0.675	0.675	Q2TB90.pdb.gz	HKDC1_HUMAN Hexokinase HKDC1 OS=Homo sapiens OX=9606 GN=HKDC1 PE=1 SV=3
8	AFDB:Q8AYP7	0.989	0.990	0.000	916	0.859	0.860	Q8AYP7.pdb.gz	Q8AYP7_CHICK hexokinase OS=Gallus gallus OX=9031 GN=HK2 PE=2 SV=1
9	AFDB:Q8AYP8	0.918	0.918	0.000	917	0.744	0.744	Q8AYP8.pdb.gz	Q8AYP8_CHICK hexokinase OS=Gallus gallus OX=9031 GN=HK1 PE=2 SV=1
10	AFDB:P52790	0.874	0.869	8.215E-100	923	0.551	0.547	P52790.pdb.gz	HXK3_HUMAN Hexokinase-3 OS=Homo sapiens OX=9606 GN=HK3 PE=1 SV=2
11	AFDB:P27926	0.790	0.784	1.636E-97	924	0.552	0.548	P27926.pdb.gz	HXK3_RAT Hexokinase-3 OS=Rattus norvegicus OX=10116 GN=Hk3 PE=1 SV=1
12	AFDB:P17712	0.496	0.973	3.752E-50	465	0.273	0.538	P17712.pdb.gz	HXK4_RAT Hexokinase-4 OS=Rattus norvegicus OX=10116 GN=Gck PE=1 SV=2
13	AFDB:F1RC38	0.490	0.938	2.222E-49	476	0.281	0.542	F1RC38.pdb.gz	F1RC38_DANRE Phosphotransferase OS=Danio rerio OX=7955 GN=fb57f10 PE=3 SV=2
14	AFDB:A0A5F9ZHE0	0.486	0.912	2.865E-49	486	0.262	0.494	A0A5F9ZHE0.pdb.gz	A0A5F9ZHE0_HUMAN Phosphotransferase OS=Homo sapiens OX=9606 GN=GCK PE=1 SV=1
15	PDB:3idhA	0.478	0.953	8.549E-46	453	0.273	0.552	3idhA.pdb.gz	The active conformation of human glucokinase is not altered by allosteric activators
16	PDB:4dchA	0.404	0.813	3.018E-39	434	0.250	0.528	4dchA.pdb.gz	Insights into Mechanism of Glucokinase Activation: OBSERVATION OF MULTIPLE DISTINCT PROTEIN CONFORMATIONS.
17	PDB:6jj7A	0.445	0.855	2.704E-32	465	0.188	0.370	6jj7A.pdb.gz	Crystal structure of OsHXK6-Glc complex
18	PDB:3b8aX	0.451	0.861	5.952E-31	470	0.166	0.323	3b8aX.pdb.gz	Crystal structure of yeast hexokinase PI in complex with glucose: A classical "induced fit" example revised.
19	PDB:4qs7A	0.438	0.859	2.212E-30	455	0.168	0.338	4qs7A.pdb.gz	Biochemical and structural study of Arabidopsis hexokinase 1
20	PDB:1ig8A	0.438	0.824	4.869E-29	469	0.160	0.313	1ig8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PB90	0.0	1830	889	0.969	1.000	E9PB90_HUMAN hexokinase OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=1
2	O08528	0.0	1786	917	0.942	0.942	HXK2_MOUSE Hexokinase-2 OS=Mus musculus OX=10090 GN=Hk2 PE=1 SV=1
3	P05708	0.0	1410	918	0.724	0.723	HXK1_RAT Hexokinase-1 OS=Rattus norvegicus OX=10116 GN=Hk1 PE=1 SV=4
4	P17710	0.0	1396	974	0.708	0.666	HXK1_MOUSE Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3
5	P19367	0.0	1439	917	0.734	0.734	HXK1_HUMAN Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1 PE=1 SV=3
6	P27881	0.0	1788	917	0.944	0.944	HXK2_RAT Hexokinase-2 OS=Rattus norvegicus OX=10116 GN=Hk2 PE=1 SV=1
7	P27926	0.0	1044	924	0.553	0.549	HXK3_RAT Hexokinase-3 OS=Rattus norvegicus OX=10116 GN=Hk3 PE=1 SV=1
8	P52789	0.0	1891	917	1.000	1.000	HXK2_HUMAN Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2
9	P52790	0.0	1024	923	0.552	0.548	HXK3_HUMAN Hexokinase-3 OS=Homo sapiens OX=9606 GN=HK3 PE=1 SV=2
10	Q2TB90	0.0	1313	917	0.676	0.676	HKDC1_HUMAN Hexokinase HKDC1 OS=Homo sapiens OX=9606 GN=HKDC1 PE=1 SV=3
11	Q3TRM8	0.0	1010	922	0.545	0.542	HXK3_MOUSE Hexokinase-3 OS=Mus musculus OX=10090 GN=Hk3 PE=1 SV=2
12	Q8AYP7	0.0	1652	916	0.859	0.860	Q8AYP7_CHICK hexokinase OS=Gallus gallus OX=9031 GN=HK2 PE=2 SV=1
13	Q8AYP8	0.0	1455	917	0.745	0.745	Q8AYP8_CHICK hexokinase OS=Gallus gallus OX=9031 GN=HK1 PE=2 SV=1
14	Q91W97	0.0	1332	915	0.677	0.679	HKDC1_MOUSE Hexokinase HKDC1 OS=Mus musculus OX=10090 GN=Hkdc1 PE=2 SV=1
15	P35557	1.53e-175	518	465	0.273	0.538	HXK4_HUMAN Hexokinase-4 OS=Homo sapiens OX=9606 GN=GCK PE=1 SV=1
16	Q53Y25	1.53e-175	518	465	0.273	0.538	Q53Y25_HUMAN Phosphotransferase OS=Homo sapiens OX=9606 GN=GCK PE=2 SV=1
17	P17712	6.62e-175	517	465	0.272	0.535	HXK4_RAT Hexokinase-4 OS=Rattus norvegicus OX=10116 GN=Gck PE=1 SV=2
18	P52792	2.44e-174	515	465	0.269	0.531	HXK4_MOUSE Hexokinase-4 OS=Mus musculus OX=10090 GN=Gck PE=1 SV=1
19	A0A5F9ZGW4	3.56e-174	514	456	0.272	0.546	A0A5F9ZGW4_HUMAN Phosphotransferase OS=Homo sapiens OX=9606 GN=GCK PE=1 SV=1
20	O93314	4.95e-174	514	471	0.278	0.541	O93314_ONCMY Phosphotransferase OS=Oncorhynchus mykiss OX=8022 GN=GK PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15236 CCDC66	2.3e+02	13.0	Coiled-coil domain-containing protein 66
2	PF00370 FGGY_N	0.81	20.8	FGGY family of carbohydrate kinases, N-terminal domain
3	PF00349 Hexokinase_1	6.3e-139	471.9	Hexokinase
4	PF03727 Hexokinase_2	2.2e-161	546.3	Hexokinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290573

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265333	0.998	Voltage-dependent anion-selective channel protein 1
2	9606.ENSP00000179259	0.984	Fructose-2,6-bisphosphatase TIGAR
3	9606.ENSP00000405573	0.975	Glucose-6-phosphate isomerase
4	9606.ENSP00000377192	0.965	Glucose-6-phosphate 1-dehydrogenase
5	9606.ENSP00000408025	0.964	Fructose-1,6-bisphosphatase 1
6	9606.ENSP00000364486	0.948	Fructose-1,6-bisphosphatase isozyme 2
7	9606.ENSP00000402103	0.947	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
8	9606.ENSP00000360124	0.945	Phosphoglucomutase-1
9	9606.ENSP00000264029	0.944	Trehalase
10	9606.ENSP00000349860	0.938	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
11	9606.ENSP00000253778	0.936	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
12	9606.ENSP00000292432	0.936	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
13	9606.ENSP00000318318	0.934	Mannose-6-phosphate isomerase
14	9606.ENSP00000345771	0.934	ATP-dependent 6-phosphofructokinase, muscle type
15	9606.ENSP00000371393	0.932	Phosphoglucomutase-2
16	9606.ENSP00000473348	0.932	GDH/6PGL endoplasmic bifunctional protein
17	9606.ENSP00000216410	0.930	Glucosamine-phosphate N-acetyltransferase 1
18	9606.ENSP00000260599	0.928	Ketohexokinase
19	9606.ENSP00000267814	0.924	Sorbitol dehydrogenase
20	9606.ENSP00000295448	0.923	Glucosamine-6-phosphate deaminase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004340	0.999	glucokinase activity
GO:0005515	0.988	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0006793	0.981	phosphorus metabolic process
GO:0005996	0.955	monosaccharide metabolic process
GO:0019318	0.932	hexose metabolic process
GO:0016052	0.932	carbohydrate catabolic process
GO:0006796	0.910	phosphate-containing compound metabolic process
GO:0006006	0.898	glucose metabolic process
GO:1901135	0.892	carbohydrate derivative metabolic process
GO:0019637	0.881	organophosphate metabolic process
GO:0016310	0.874	phosphorylation
GO:0051179	0.848	localization
GO:0065007	0.815	biological regulation
GO:0006807	0.717	nitrogen compound metabolic process
GO:0050789	0.560	regulation of biological process
GO:0051234	0.499	establishment of localization
GO:0050794	0.479	regulation of cellular process
GO:1901564	0.459	organonitrogen compound metabolic process
GO:0050896	0.445	response to stimulus
GO:0006091	0.426	generation of precursor metabolites and energy
GO:0055086	0.398	nucleobase-containing small molecule metabolic process
GO:0019222	0.343	regulation of metabolic process
GO:0048518	0.339	positive regulation of biological process
GO:0019752	0.333	carboxylic acid metabolic process
GO:0006163	0.320	purine nucleotide metabolic process
GO:0051716	0.309	cellular response to stimulus
GO:0046365	0.303	monosaccharide catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005739	0.998	mitochondrion
GO:0016020	0.607	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17825	0.999	ATP + D-glucose = ADP + D-glucose 6-phosphate + H(+)
EC:2.7.1.2	0.999	glucokinase.

[back to server]