StarFunc result for job id P52797

User Input

>input (238 residues)
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI
KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPT
LPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52797	1.000	1.000	1.301E-47	238	1.000	1.000	P52797.pdb.gz	EFNA3_HUMAN Ephrin-A3 OS=Homo sapiens OX=9606 GN=EFNA3 PE=1 SV=1
2	AFDB:A0A0B5JFB8	0.576	0.700	9.025E-26	194	0.525	0.644	A0A0B5JFB8.pdb.gz
3	AFDB:O08543	0.544	0.567	3.201E-19	228	0.361	0.377	O08543.pdb.gz	EFNA5_MOUSE Ephrin-A5 OS=Mus musculus OX=10090 GN=Efna5 PE=1 SV=1
4	AFDB:P52793	0.521	0.601	8.186E-19	205	0.345	0.400	P52793.pdb.gz	EFNA1_MOUSE Ephrin-A1 OS=Mus musculus OX=10090 GN=Efna1 PE=1 SV=1
5	AFDB:O43921	0.524	0.582	9.205E-19	213	0.403	0.451	O43921.pdb.gz	EFNA2_HUMAN Ephrin-A2 OS=Homo sapiens OX=9606 GN=EFNA2 PE=1 SV=1
6	AFDB:P79728	0.529	0.551	1.561E-18	228	0.361	0.377	P79728.pdb.gz	EFNA5_DANRE Ephrin-A5b OS=Danio rerio OX=7955 GN=efna5b PE=1 SV=1
7	AFDB:A0A0B5JK29	0.542	0.734	1.755E-18	173	0.328	0.451	A0A0B5JK29.pdb.gz
8	AFDB:Q98TZ1	0.558	0.650	2.093E-18	202	0.357	0.421	Q98TZ1.pdb.gz	Q98TZ1_CHICK Ephrin-A6 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
9	AFDB:P20827	0.556	0.638	2.807E-18	205	0.340	0.395	P20827.pdb.gz	EFNA1_HUMAN Ephrin-A1 OS=Homo sapiens OX=9606 GN=EFNA1 PE=1 SV=2
10	AFDB:P52798	0.526	0.617	2.462E-17	201	0.336	0.398	P52798.pdb.gz	EFNA4_HUMAN Ephrin-A4 OS=Homo sapiens OX=9606 GN=EFNA4 PE=1 SV=1
11	PDB:4v96AA	0.228	0.192	6.426E-3	299	0.050	0.040	4v96AA.pdb.gz
12	PDB:2aanA	0.236	0.386	6.815E-3	123	0.067	0.130	2aanA.pdb.gz	The Crystal Structure of Auracyanin A at 1.85 A Resolution: Why the Photosynthetic Bacterium Chloroflexus Needs Two Almost Identical 'Blue' Copper Proteins
13	PDB:6cjzA	0.251	0.505	2.955E-2	105	0.067	0.152	6cjzA.pdb.gz
14	PDB:1kiuB	0.160	0.141	4.202E-2	279	0.067	0.057	1kiuB.pdb.gz	Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.
15	PDB:3divA	0.210	0.111	5.011E-2	499	0.092	0.044	3divA.pdb.gz	Crystal Structure of laccase from Cerrena maxima at 1.76A resolution.
16	PDB:4n2iA	0.227	0.097	5.636E-2	662	0.050	0.018	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
17	PDB:4alcA	0.222	0.292	6.337E-2	166	0.063	0.090	4alcA.pdb.gz	Structural and Electronic Snapshots During the Transition from a Cu(II) to Cu(I) Metal Center of a Lytic Polysaccharide Monooxygenase by X-Ray Photo-Reduction.
18	PDB:6dlfA	0.199	0.201	7.557E-2	236	0.055	0.055	6dlfA.pdb.gz
19	PDB:3nvqA	0.225	0.107	8.014E-2	588	0.046	0.019	3nvqA.pdb.gz
20	PDB:2nnrA	0.227	0.430	1.075E-1	110	0.088	0.191	2nnrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52797	9.65e-180	494	238	1.000	1.000	EFNA3_HUMAN Ephrin-A3 OS=Homo sapiens OX=9606 GN=EFNA3 PE=1 SV=1
2	A0A0G2JV56	7.88e-164	453	230	0.933	0.965	A0A0G2JV56_RAT Ephrin A3 OS=Rattus norvegicus OX=10116 GN=Efna3 PE=3 SV=2
3	O08545	7.88e-164	453	230	0.933	0.965	EFNA3_MOUSE Ephrin-A3 OS=Mus musculus OX=10090 GN=Efna3 PE=1 SV=4
4	A0A8I5ZVQ1	1.12e-121	346	204	0.727	0.848	A0A8I5ZVQ1_RAT Ephrin A3 OS=Rattus norvegicus OX=10116 GN=Efna3 PE=3 SV=1
5	P52803	3.05e-49	163	228	0.336	0.351	EFNA5_HUMAN Ephrin-A5 OS=Homo sapiens OX=9606 GN=EFNA5 PE=1 SV=1
6	P97605	3.40e-49	162	228	0.336	0.351	EFNA5_RAT Ephrin-A5 OS=Rattus norvegicus OX=10116 GN=Efna5 PE=1 SV=2
7	O08543	4.17e-49	162	228	0.336	0.351	EFNA5_MOUSE Ephrin-A5 OS=Mus musculus OX=10090 GN=Efna5 PE=1 SV=1
8	Q98TZ1	1.08e-46	155	202	0.315	0.371	Q98TZ1_CHICK Ephrin-A6 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
9	P79728	3.66e-46	155	228	0.324	0.338	EFNA5_DANRE Ephrin-A5b OS=Danio rerio OX=7955 GN=efna5b PE=1 SV=1
10	F1MA19	3.79e-45	152	209	0.336	0.383	F1MA19_RAT Ephrin A2 OS=Rattus norvegicus OX=10116 GN=Efna2 PE=3 SV=1
11	P52801	3.79e-45	152	209	0.336	0.383	EFNA2_MOUSE Ephrin-A2 OS=Mus musculus OX=10090 GN=Efna2 PE=1 SV=1
12	P20827	1.95e-44	150	205	0.307	0.356	EFNA1_HUMAN Ephrin-A1 OS=Homo sapiens OX=9606 GN=EFNA1 PE=1 SV=2
13	O43921	1.06e-43	148	213	0.336	0.376	EFNA2_HUMAN Ephrin-A2 OS=Homo sapiens OX=9606 GN=EFNA2 PE=1 SV=1
14	P97553	3.68e-43	146	205	0.307	0.356	EFNA1_RAT Ephrin-A1 OS=Rattus norvegicus OX=10116 GN=Efna1 PE=2 SV=2
15	P52793	3.40e-42	144	205	0.307	0.356	EFNA1_MOUSE Ephrin-A1 OS=Mus musculus OX=10090 GN=Efna1 PE=1 SV=1
16	P52798	1.03e-33	122	201	0.311	0.368	EFNA4_HUMAN Ephrin-A4 OS=Homo sapiens OX=9606 GN=EFNA4 PE=1 SV=1
17	A5HTT2	1.82e-10	62.0	340	0.176	0.124	A5HTT2_RAT Ephrin B3 OS=Rattus norvegicus OX=10116 GN=Efnb3 PE=2 SV=1
18	O35393	1.82e-10	62.0	340	0.176	0.124	EFNB3_MOUSE Ephrin-B3 OS=Mus musculus OX=10090 GN=Efnb3 PE=1 SV=1
19	P52800	1.88e-10	62.0	336	0.227	0.161	EFNB2_MOUSE Ephrin-B2 OS=Mus musculus OX=10090 GN=Efnb2 PE=1 SV=1
20	Q90Z31	2.25e-10	61.6	331	0.202	0.145	Q90Z31_DANRE Ephrin B3 OS=Danio rerio OX=7955 GN=efnb3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00812 Ephrin	2.8e-42	155.5	Ephrin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010362954.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010353752.1	0.978	Ephrin type-A receptor 4
2	61622.XP_010380463.1	0.948	Ephrin type-A receptor 3 isoform X1
3	61622.XP_010356323.1	0.944	Ephrin type-A receptor 7 isoform X1
4	61622.XP_010377732.1	0.940	Ephrin type-A receptor 1
5	61622.XP_010378451.1	0.938	Ephrin type-A receptor 5 isoform X1
6	61622.XP_010376832.1	0.935	Ephrin type-A receptor 2
7	61622.XP_010362675.1	0.918	Ephrin type-A receptor 8
8	61622.XP_010378743.1	0.903	Ephrin type-A receptor 6-like isoform X1
9	61622.XP_010369949.1	0.859	Tyrosine-protein kinase Fyn isoform X1
10	61622.XP_010352986.1	0.855	RAS p21 protein activator 1
11	61622.XP_010363135.1	0.830	Ephrin type-B receptor 1
12	61622.XP_010364461.1	0.821	Ephrin type-B receptor 3
13	61622.XP_010362660.1	0.806	EPH receptor B2
14	61622.XP_010376039.1	0.797	Ephrin type-B receptor 4
15	61622.XP_010377683.1	0.787	Ephrin type-B receptor 6
16	61622.XP_010357075.1	0.780	EPH receptor A6
17	61622.XP_010378745.1	0.769	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins
18	61622.XP_010350981.1	0.761	Ephrin type-A receptor 10-like
19	61622.XP_010350982.1	0.761	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
20	61622.XP_010379586.1	0.754	Neurotrophic receptor tyrosine kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046875	1.000	ephrin receptor binding
GO:0016772	0.985	transferase activity, transferring phosphorus-containing groups
GO:0004714	0.981	transmembrane receptor protein tyrosine kinase activity
GO:0005003	0.752	ephrin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007166	0.997	cell surface receptor signaling pathway
GO:0007169	0.987	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048013	0.978	ephrin receptor signaling pathway
GO:0048518	0.751	positive regulation of biological process
GO:0019222	0.678	regulation of metabolic process
GO:0060255	0.668	regulation of macromolecule metabolic process
GO:0080090	0.660	regulation of primary metabolic process
GO:0051171	0.650	regulation of nitrogen compound metabolic process
GO:0050793	0.615	regulation of developmental process
GO:0051246	0.595	regulation of protein metabolic process
GO:0048519	0.514	negative regulation of biological process
GO:0051336	0.481	regulation of hydrolase activity
GO:0010604	0.376	positive regulation of macromolecule metabolic process
GO:0044093	0.374	positive regulation of molecular function
GO:0051173	0.373	positive regulation of nitrogen compound metabolic process
GO:0043085	0.362	positive regulation of catalytic activity
GO:0051239	0.356	regulation of multicellular organismal process
GO:0051247	0.354	positive regulation of protein metabolic process
GO:0048522	0.326	positive regulation of cellular process
GO:0051345	0.315	positive regulation of hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.368	intracellular membrane-bounded organelle
GO:0005737	0.330	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	0.985	Transferring phosphorus-containing groups.
EC:2.7.10.1	0.981	receptor protein-tyrosine kinase.

[back to server]