StarFunc result for job id P52799

User Input

>input (333 residues)
MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDI
ICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPN
LWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPT
RRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIV
IIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVF
CPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2B9A9	0.696	0.691	1.708E-58	336	0.970	0.961	B2B9A9.pdb.gz
2	AFDB:O73874	0.721	0.723	6.944E-44	332	0.652	0.654	O73874.pdb.gz	EFNB2_DANRE Ephrin-B2a OS=Danio rerio OX=7955 GN=efnb2a PE=1 SV=1
3	AFDB:Q90Z32	0.636	0.634	1.394E-38	334	0.532	0.530	Q90Z32.pdb.gz	Q90Z32_DANRE Ephrin-B2b OS=Danio rerio OX=7955 GN=fc10d03 PE=2 SV=1
4	AFDB:O73612	0.606	0.605	4.845E-38	334	0.565	0.563	O73612.pdb.gz	EFNB1_CHICK Ephrin-B1 OS=Gallus gallus OX=9031 GN=EFNB1 PE=2 SV=1
5	AFDB:P98172	0.633	0.612	2.772E-37	346	0.583	0.561	P98172.pdb.gz	EFNB1_HUMAN Ephrin-B1 OS=Homo sapiens OX=9606 GN=EFNB1 PE=1 SV=1
6	AFDB:O13097	0.650	0.657	4.563E-37	329	0.571	0.578	O13097.pdb.gz	EFNB1_XENLA Ephrin-B1 OS=Xenopus laevis OX=8355 GN=efnb1 PE=1 SV=2
7	AFDB:A0A2R8Q1M3	0.458	0.416	7.528E-36	369	0.568	0.512	A0A2R8Q1M3.pdb.gz
8	AFDB:Q502Q3	0.536	0.524	4.347E-31	342	0.492	0.480	Q502Q3.pdb.gz
9	AFDB:A5HTT2	0.463	0.454	4.122E-27	340	0.393	0.385	A5HTT2.pdb.gz	A5HTT2_RAT Ephrin B3 OS=Rattus norvegicus OX=10116 GN=Efnb3 PE=2 SV=1
10	AFDB:G5EEE7	0.410	0.482	1.371E-18	279	0.189	0.226	G5EEE7.pdb.gz	G5EEE7_CAEEL Ephrin RBD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-2 PE=2 SV=1
11	PDB:1kcwA	0.158	0.064	4.752E-3	1017	0.057	0.019	1kcwA.pdb.gz	The X-ray structure of human serum ceruloplasmin at 3.1 angstrom: Nature of the copper centres.
12	PDB:2bo0A	0.130	0.129	6.489E-3	336	0.048	0.048	2bo0A.pdb.gz	High Resolution Structural Studies of Mutants Provide Insights Into Catalysis and Electron Transfer Processes in Copper Nitrite Reductase
13	PDB:4bxsV	0.171	0.057	1.288E-2	1262	0.069	0.018	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
14	PDB:2aanA	0.199	0.409	2.719E-2	123	0.051	0.138	2aanA.pdb.gz	The Crystal Structure of Auracyanin A at 1.85 A Resolution: Why the Photosynthetic Bacterium Chloroflexus Needs Two Almost Identical 'Blue' Copper Proteins
15	PDB:6mjrA	0.212	0.449	3.080E-2	128	0.030	0.078	6mjrA.pdb.gz	Two Tryptophans Are Better Than One in Accelerating Electron Flow through a Protein.
16	PDB:7kveB	0.184	0.055	3.488E-2	1374	0.054	0.013	7kveB.pdb.gz
17	PDB:5n4lA	0.157	0.063	3.713E-2	1034	0.045	0.015	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
18	PDB:7d4yB	0.146	0.092	3.713E-2	601	0.033	0.018	7d4yB.pdb.gz
19	PDB:3divA	0.187	0.137	3.951E-2	499	0.069	0.046	3divA.pdb.gz	Crystal Structure of laccase from Cerrena maxima at 1.76A resolution.
20	PDB:3fszA	0.204	0.417	5.395E-2	129	0.036	0.093	3fszA.pdb.gz	Metal-binding loop length and not sequence dictates structure.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AJ66	0.0	562	305	0.868	0.948	A0A8I6AJ66_RAT Ephrin B2 OS=Rattus norvegicus OX=10116 GN=Efnb2 PE=3 SV=1
2	P52799	0.0	692	333	1.000	1.000	EFNB2_HUMAN Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1
3	P52800	0.0	674	336	0.961	0.952	EFNB2_MOUSE Ephrin-B2 OS=Mus musculus OX=10090 GN=Efnb2 PE=1 SV=1
4	O73874	4.27e-150	427	332	0.652	0.654	EFNB2_DANRE Ephrin-B2a OS=Danio rerio OX=7955 GN=efnb2a PE=1 SV=1
5	Q90Z32	1.32e-132	382	334	0.574	0.572	Q90Z32_DANRE Ephrin-B2b OS=Danio rerio OX=7955 GN=fc10d03 PE=2 SV=1
6	P52796	1.41e-125	365	345	0.565	0.545	EFNB1_RAT Ephrin-B1 OS=Rattus norvegicus OX=10116 GN=Efnb1 PE=1 SV=1
7	P52795	2.33e-125	364	345	0.571	0.551	EFNB1_MOUSE Ephrin-B1 OS=Mus musculus OX=10090 GN=Efnb1 PE=1 SV=1
8	P98172	4.21e-125	364	346	0.565	0.543	EFNB1_HUMAN Ephrin-B1 OS=Homo sapiens OX=9606 GN=EFNB1 PE=1 SV=1
9	O73612	4.34e-121	353	334	0.586	0.584	EFNB1_CHICK Ephrin-B1 OS=Gallus gallus OX=9031 GN=EFNB1 PE=2 SV=1
10	O13097	2.97e-117	343	329	0.559	0.565	EFNB1_XENLA Ephrin-B1 OS=Xenopus laevis OX=8355 GN=efnb1 PE=1 SV=2
11	Q90Z33	3.45e-115	338	341	0.577	0.563	Q90Z33_DANRE Ephrin-B1 OS=Danio rerio OX=7955 GN=efnb1 PE=2 SV=1
12	Q90Z31	3.25e-103	308	331	0.492	0.495	Q90Z31_DANRE Ephrin B3 OS=Danio rerio OX=7955 GN=efnb3 PE=1 SV=1
13	A5HTT2	9.45e-75	235	340	0.402	0.394	A5HTT2_RAT Ephrin B3 OS=Rattus norvegicus OX=10116 GN=Efnb3 PE=2 SV=1
14	O35393	9.45e-75	235	340	0.402	0.394	EFNB3_MOUSE Ephrin-B3 OS=Mus musculus OX=10090 GN=Efnb3 PE=1 SV=1
15	G3V7D4	6.03e-72	228	340	0.393	0.385	G3V7D4_RAT Ephrin B3 OS=Rattus norvegicus OX=10116 GN=Efnb3 PE=3 SV=1
16	Q15768	9.08e-72	228	340	0.393	0.385	EFNB3_HUMAN Ephrin-B3 OS=Homo sapiens OX=9606 GN=EFNB3 PE=1 SV=1
17	G5EEE7	1.10e-20	92.0	279	0.147	0.176	G5EEE7_CAEEL Ephrin RBD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-2 PE=2 SV=1
18	P52793	6.20e-14	71.6	205	0.135	0.220	EFNA1_MOUSE Ephrin-A1 OS=Mus musculus OX=10090 GN=Efna1 PE=1 SV=1
19	Q9V4E1	7.93e-14	74.3	652	0.156	0.080	Q9V4E1_DROME Ephrin OS=Drosophila melanogaster OX=7227 GN=Ephrin PE=2 SV=2
20	P97553	8.87e-13	68.6	205	0.132	0.215	EFNA1_RAT Ephrin-A1 OS=Rattus norvegicus OX=10116 GN=Efna1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14316 DUF4381	8.4e+02	11.6	Domain of unknown function (DUF4381)
2	PF15820 ECSCR	4e+02	12.2	Endothelial cell-specific chemotaxis regulator
3	PF00812 Ephrin	1.8e-47	172.3	Ephrin
4	PF15706 TMEM132D_C	3.5	18.8	Mature oligodendrocyte transmembrane protein, TMEM132D, C-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245323

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281821	0.999	Ephrin type-A receptor 4
2	9606.ENSP00000332118	0.999	Ephrin type-B receptor 3
3	9606.ENSP00000350896	0.999	Ephrin type-B receptor 4
4	9606.ENSP00000363763	0.999	Ephrin type-B receptor 2
5	9606.ENSP00000381097	0.999	Ephrin type-B receptor 1
6	9606.ENSP00000275815	0.993	Ephrin type-A receptor 1
7	9606.ENSP00000233154	0.990	Cytoplasmic protein NCK2
8	9606.ENSP00000337451	0.987	Ephrin type-A receptor 3
9	9606.ENSP00000481994	0.968	Ephrin type-B receptor 6
10	9606.ENSP00000480763	0.964	Ephrin type-A receptor 5
11	9606.ENSP00000362680	0.959	Proto-oncogene tyrosine-protein kinase Src
12	9606.ENSP00000351209	0.950	Ephrin type-A receptor 2
13	9606.ENSP00000361405	0.941	Matrix metalloproteinase-9
14	9606.ENSP00000300574	0.939	Adapter molecule crk
15	9606.ENSP00000358309	0.937	Ephrin type-A receptor 7
16	9606.ENSP00000260130	0.936	Syntenin-1
17	9606.ENSP00000383118	0.935	Cell division control protein 42 homolog
18	9606.ENSP00000204961	0.933	Ephrin-B1
19	9606.ENSP00000370719	0.929	Intersectin-1
20	9606.ENSP00000363255	0.928	Regulator of G-protein signaling 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046875	0.995	ephrin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0032501	0.988	multicellular organismal process
GO:0048856	0.988	anatomical structure development
GO:0050896	0.985	response to stimulus
GO:0050794	0.981	regulation of cellular process
GO:0048731	0.978	system development
GO:0023052	0.975	signaling
GO:0051716	0.967	cellular response to stimulus
GO:0007154	0.964	cell communication
GO:0009653	0.961	anatomical structure morphogenesis
GO:0072359	0.936	circulatory system development
GO:0001568	0.934	blood vessel development
GO:0034330	0.932	cell junction organization
GO:0048518	0.900	positive regulation of biological process
GO:0007169	0.898	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0001525	0.884	angiogenesis
GO:0048519	0.845	negative regulation of biological process
GO:0048522	0.841	positive regulation of cellular process
GO:0034329	0.837	cell junction assembly
GO:0030155	0.823	regulation of cell adhesion
GO:0048523	0.818	negative regulation of cellular process
GO:0040012	0.803	regulation of locomotion
GO:0008284	0.798	positive regulation of cell population proliferation
GO:0016477	0.779	cell migration
GO:0007155	0.759	cell adhesion
GO:0051128	0.754	regulation of cellular component organization
GO:0001667	0.735	ameboidal-type cell migration
GO:0042221	0.714	response to chemical
GO:0007399	0.692	nervous system development
GO:0048583	0.677	regulation of response to stimulus
GO:0051239	0.655	regulation of multicellular organismal process
GO:0009605	0.587	response to external stimulus
GO:0070887	0.586	cellular response to chemical stimulus
GO:0071310	0.550	cellular response to organic substance
GO:0019222	0.520	regulation of metabolic process
GO:0090130	0.483	tissue migration
GO:0060255	0.467	regulation of macromolecule metabolic process
GO:1901700	0.463	response to oxygen-containing compound
GO:2000145	0.460	regulation of cell motility
GO:0099054	0.453	presynapse assembly
GO:0030334	0.432	regulation of cell migration
GO:0048013	0.422	ephrin receptor signaling pathway
GO:1901701	0.413	cellular response to oxygen-containing compound
GO:0051171	0.361	regulation of nitrogen compound metabolic process
GO:0080090	0.354	regulation of primary metabolic process
GO:0031323	0.349	regulation of cellular metabolic process
GO:0071216	0.347	cellular response to biotic stimulus
GO:0009893	0.334	positive regulation of metabolic process
GO:0071222	0.331	cellular response to lipopolysaccharide
GO:0050793	0.328	regulation of developmental process
GO:0048869	0.328	cellular developmental process
GO:0023051	0.328	regulation of signaling
GO:0030154	0.322	cell differentiation
GO:0010941	0.318	regulation of cell death
GO:0010646	0.318	regulation of cell communication
GO:0010604	0.310	positive regulation of macromolecule metabolic process
GO:0048513	0.306	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0030054	0.997	cell junction
GO:0043226	0.942	organelle
GO:0005622	0.906	intracellular anatomical structure
GO:0043229	0.836	intracellular organelle
GO:0005737	0.774	cytoplasm
GO:0005829	0.731	cytosol
GO:0043227	0.723	membrane-bounded organelle
GO:0098590	0.658	plasma membrane region
GO:0043231	0.639	intracellular membrane-bounded organelle
GO:0045202	0.608	synapse
GO:0012505	0.393	endomembrane system
GO:0098978	0.375	glutamatergic synapse
GO:0098793	0.369	presynapse
GO:0070013	0.353	intracellular organelle lumen
GO:0005634	0.330	nucleus
GO:0042734	0.329	presynaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]